PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G30340.1
Common NameASL10, LBD13, T9D9.15
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family LBD
Protein Properties Length: 268aa    MW: 29090.7 Da    PI: 8.1465
Description LOB domain-containing protein 13
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G30340.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260125.82.1e-39521511100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk+lrr+Ca++C+++pyf  ++p+kfa+vhk+FGasnv+k+l ++ e++r da++slvyeA+ r+rdP+yG++g i++lq+++++l++el +++
  AT2G30340.1  52 PCAACKLLRRRCAEECPFSPYFSPHEPHKFAAVHKVFGASNVSKMLLEVGESQRGDAANSLVYEANLRLRDPIYGCMGAISALQHHIQSLQSELTTVR 149
                  7*********************************************************************************************9998 PP

       DUF260  99 ee 100
                  +e
  AT2G30340.1 150 TE 151
                  86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.18951152IPR004883Lateral organ boundaries, LOB
PfamPF031953.8E-4052149IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008150Biological Processbiological_process
GO:0016020Cellular Componentmembrane
GO:0003674Molecular Functionmolecular_function
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009005anatomyroot
PO:0009025anatomyvascular leaf
Sequence ? help Back to Top
Protein Sequence    Length: 268 aa     Download sequence    Send to blast
MSREREGFGE YYETVKKIKK DPAFETTTDH AVMGIRRHVA VPPGTTLNTV TPCAACKLLR  60
RRCAEECPFS PYFSPHEPHK FAAVHKVFGA SNVSKMLLEV GESQRGDAAN SLVYEANLRL  120
RDPIYGCMGA ISALQHHIQS LQSELTTVRT EILRHKYQEA TTITSLQNNF NSTTTTSSVS  180
CDQHALASAI LLPPPPPPPP TPRPPRLLSS QPAPPPTPPV SLPSPSMVVS SSSSSNSSAT  240
NSMYNPPPSS TAGYSNSLSS DNNVHYFD
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.122420.0root
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1865042430.0
Genevisible255873_at0.0
Expression AtlasAT2G30340-
AtGenExpressAT2G30340-
ATTED-IIAT2G30340-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in shoots and roots and at low levels in flowers, but not in leaves or inflorescence stems. {ECO:0000269|PubMed:12068116}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00283DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G30340.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Interaction ? help Back to Top
Source Intact With
BioGRIDAT1G31320, AT1G65620
IntActSearch Q9AT61
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G30340
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0260520.0BT026052.1 Arabidopsis thaliana At2g30340 mRNA, complete cds.
GenBankAB4738430.0AB473843.1 Arabidopsis thaliana ASL10 mRNA for ASYMMETRIC LEAVES2-like 10 protein, complete cds.
GenBankAF4478880.0AF447888.1 Arabidopsis thaliana LOB DOMAIN 13 (LBD13) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_850141.10.0LOB domain-containing protein 13
SwissprotQ9AT610.0LBD13_ARATH; LOB domain-containing protein 13
TrEMBLD7LBM71e-136D7LBM7_ARALL; Putative uncharacterized protein
STRINGAT2G30340.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6016318
MalvidsOGEM19272781
Publications ? help Back to Top
  1. Iwakawa H, et al.
    The ASYMMETRIC LEAVES2 gene of Arabidopsis thaliana, required for formation of a symmetric flat leaf lamina, encodes a member of a novel family of proteins characterized by cysteine repeats and a leucine zipper.
    Plant Cell Physiol., 2002. 43(5): p. 467-78
    [PMID:12040093]
  2. Shuai B,Reynaga-Peña CG,Springer PS
    The lateral organ boundaries gene defines a novel, plant-specific gene family.
    Plant Physiol., 2002. 129(2): p. 747-61
    [PMID:12068116]
  3. Xiao YL,Malik M,Whitelaw CA,Town CD
    Cloning and sequencing of cDNAs for hypothetical genes from chromosome 2 of Arabidopsis.
    Plant Physiol., 2002. 130(4): p. 2118-28
    [PMID:12481096]
  4. Mitra SK,Gantt JA,Ruby JF,Clouse SD,Goshe MB
    Membrane proteomic analysis of Arabidopsis thaliana using alternative solubilization techniques.
    J. Proteome Res., 2007. 6(5): p. 1933-50
    [PMID:17432890]
  5. Matsumura Y,Iwakawa H,Machida Y,Machida C
    Characterization of genes in the ASYMMETRIC LEAVES2/LATERAL ORGAN BOUNDARIES (AS2/LOB) family in Arabidopsis thaliana, and functional and molecular comparisons between AS2 and other family members.
    Plant J., 2009. 58(3): p. 525-37
    [PMID:19154202]
  6. Arabidopsis Interactome Mapping Consortium
    Evidence for network evolution in an Arabidopsis interactome map.
    Science, 2011. 333(6042): p. 601-7
    [PMID:21798944]