PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G30130.1
Common NameASL5, LBD12, PCK1, T27E13.13
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family LBD
Protein Properties Length: 193aa    MW: 21529.5 Da    PI: 7.0699
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G30130.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260140.74.8e-4481071100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +Ca+Ck+lrr+CakdC++apyfp ++p+kfa+vhk+FGasnv+k+l++lp ++r da++slv+eA+ar+rdPvyG+vg i+ lq+q++ql+ +la+++
  AT2G30130.1   8 PCASCKLLRRRCAKDCIFAPYFPPDDPHKFAIVHKVFGASNVSKMLQELPVHQRADAVNSLVFEANARVRDPVYGCVGAISYLQNQVSQLQMQLAVAQ 105
                  7**********************************************************************************************999 PP

       DUF260  99 ee 100
                  +e
  AT2G30130.1 106 AE 107
                  87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.8047108IPR004883Lateral organ boundaries, LOB
PfamPF031951.2E-438105IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009965Biological Processleaf morphogenesis
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009005anatomyroot
PO:0009029anatomystamen
PO:0009031anatomysepal
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 193 aa     Download sequence    Send to blast
MGGPGSSPCA SCKLLRRRCA KDCIFAPYFP PDDPHKFAIV HKVFGASNVS KMLQELPVHQ  60
RADAVNSLVF EANARVRDPV YGCVGAISYL QNQVSQLQMQ LAVAQAEILC IQMQNEPTLQ  120
SHHQVLELDQ DHKALLLNNN NINNCNTNNN NNNFGYAMSS GQFNSNFASP SSIMQMQMQM  180
QMQDPLKQES LWT
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO184022670.0
Genevisible267276_at0.0
Expression AtlasAT2G30130-
AtGenExpressAT2G30130-
ATTED-IIAT2G30130-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed predominantly in roots, and at low levels in shoots, floral stems and open flowers. {ECO:0000269|PubMed:12068116}.
Functional Description ? help Back to Top
Source Description
TAIROverexpression/activation tagged allele has epinastic leaves, reduced apical dominance and is sterile. Gene is similar to asymmetric leaves (AS)/lateral organ boundary (LOB) genes which repress KNOX gene expression.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G30130.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G30130
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4738380.0AB473838.1 Arabidopsis thaliana ASL5 mRNA for ASYMMETRIC LEAVES2-like 5 protein, complete cds.
GenBankAB1643060.0AB164306.1 Arabidopsis thaliana ASL5 mRNA for ASYMMETRIC LEAVES2-like gene 5 protein, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_565695.11e-143LOB domain-containing protein 12
SwissprotQ8LBW31e-145LBD12_ARATH; LOB domain-containing protein 12
TrEMBLR0HHV11e-116R0HHV1_9BRAS; Uncharacterized protein
STRINGAT2G30130.11e-142(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6016318
MalvidsOGEM13128340
Publications ? help Back to Top
  1. Iwakawa H, et al.
    The ASYMMETRIC LEAVES2 gene of Arabidopsis thaliana, required for formation of a symmetric flat leaf lamina, encodes a member of a novel family of proteins characterized by cysteine repeats and a leucine zipper.
    Plant Cell Physiol., 2002. 43(5): p. 467-78
    [PMID:12040093]
  2. Shuai B,Reynaga-Peña CG,Springer PS
    The lateral organ boundaries gene defines a novel, plant-specific gene family.
    Plant Physiol., 2002. 129(2): p. 747-61
    [PMID:12068116]
  3. Nakazawa M, et al.
    Activation tagging, a novel tool to dissect the functions of a gene family.
    Plant J., 2003. 34(5): p. 741-50
    [PMID:12787254]
  4. Lee DJ, et al.
    Genome-wide expression profiling of ARABIDOPSIS RESPONSE REGULATOR 7(ARR7) overexpression in cytokinin response.
    Mol. Genet. Genomics, 2007. 277(2): p. 115-37
    [PMID:17061125]
  5. Matsumura Y,Iwakawa H,Machida Y,Machida C
    Characterization of genes in the ASYMMETRIC LEAVES2/LATERAL ORGAN BOUNDARIES (AS2/LOB) family in Arabidopsis thaliana, and functional and molecular comparisons between AS2 and other family members.
    Plant J., 2009. 58(3): p. 525-37
    [PMID:19154202]