PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G29060.1
Common NameSCL33, T9I4.14
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family GRAS
Protein Properties Length: 694aa    MW: 78101.3 Da    PI: 5.8885
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G29060.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS363.92.2e-1113186911373
         GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlta 98 
                  l++ L++cA+avs +d + a++lL+r+++++s++gd ++Rla+yf++ L+arla+ ++++y al++++ts   +s+ l+a++++  v+P+ k++ + a
  AT2G29060.1 318 LRTMLVSCAQAVSINDRRTADELLSRIRQHSSSYGDGTERLAHYFANSLEARLAGIGTQVYTALSSKKTS---TSDMLKAYQTYISVCPFKKIAIIFA 412
                  5789**************************************************************9999...89*********************** PP

         GRAS  99 NqaIleavege..ervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledlele 192
                  N+ I++ ++++  +++HiiDf+is G+QWp+L++ La R++++ +lRiTg++ p+ g   +e + etg+rLak+++++++pfe+n+ +a+++e+++le
  AT2G29060.1 413 NHSIMRLASSAnaKTIHIIDFGISDGFQWPSLIHRLAWRRGSSCKLRITGIELPQRGfrPAEGVIETGRRLAKYCQKFNIPFEYNA-IAQKWESIKLE 509
                  ****99988776799****************************************99*****************************.7********** PP

         GRAS 193 eLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErell 290
                  +L++k+gE +aVn+ ++  +llde+v+++s+rd+vLkl+++++P+v++      ++n++ F++rf e l +ys+lfd+ +++l re+  r++ E+e+ 
  AT2G29060.1 510 DLKLKEGEFVAVNSLFRFRNLLDETVAVHSPRDTVLKLIRKIKPDVFIPGILSGSYNAPFFVTRFREVLFHYSSLFDMCDTNLTREDPMRVMFEKEFY 607
                  ************************************************************************************************** PP

         GRAS 291 greivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaW 373
                  grei+nvvaceg+er+er e++++W++r ++aGF+++pl+++ +++ kl+++  +  +++ v+++ ++l++gWk+r ++  S W
  AT2G29060.1 608 GREIMNVVACEGTERVERPESYKQWQARAMRAGFRQIPLEKELVQKLKLMVESGYkPKEFDVDQDCHWLLQGWKGRIVYGSSIW 691
                  ***************************************************99887899************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098564.689292671IPR005202Transcription factor GRAS
PfamPF035147.7E-109318691IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0006397Biological ProcessmRNA processing
GO:0008380Biological ProcessRNA splicing
GO:0005681Cellular Componentspliceosomal complex
GO:0005737Cellular Componentcytoplasm
GO:0016607Cellular Componentnuclear speck
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0003723Molecular FunctionRNA binding
GO:0042802Molecular Functionidentical protein binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000037anatomyshoot apex
PO:0000084anatomyplant sperm cell
PO:0000230anatomyinflorescence meristem
PO:0009005anatomyroot
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020100anatomyhypocotyl
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 694 aa     Download sequence    Send to blast
MGSYSAGFPG SLDWFDFPGL GNGSYLNDQP LLDIGSVPPP LDPYPQQNLA SADADFSDSV  60
LKYISQVLME EDMEDKPCMF HDALSLQAAE KSLYEALGEK YPVDDSDQPL TTTTSLAQLV  120
SSPGGSSYAS STTTTSSDSQ WSFDCLENNR PSSWLQTPIP SNFIFQSTST RASSGNAVFG  180
SSFSGDLVSN MFNDTDLALQ FKKGMEEASK FLPKSSQLVI DNSVPNRLTG KKSHWREEEH  240
LTEERSKKQS AIYVDETDEL TDMFDNILIF GEAKEQPVCI LNESFPKEPA KASTFSKSPK  300
GEKPEASGNS YTKETPDLRT MLVSCAQAVS INDRRTADEL LSRIRQHSSS YGDGTERLAH  360
YFANSLEARL AGIGTQVYTA LSSKKTSTSD MLKAYQTYIS VCPFKKIAII FANHSIMRLA  420
SSANAKTIHI IDFGISDGFQ WPSLIHRLAW RRGSSCKLRI TGIELPQRGF RPAEGVIETG  480
RRLAKYCQKF NIPFEYNAIA QKWESIKLED LKLKEGEFVA VNSLFRFRNL LDETVAVHSP  540
RDTVLKLIRK IKPDVFIPGI LSGSYNAPFF VTRFREVLFH YSSLFDMCDT NLTREDPMRV  600
MFEKEFYGRE IMNVVACEGT ERVERPESYK QWQARAMRAG FRQIPLEKEL VQKLKLMVES  660
GYKPKEFDVD QDCHWLLQGW KGRIVYGSSI WVPL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-473226918374GRAS family transcription factor containing p
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO3341845470.0
Expression AtlasAT2G29060-
AtGenExpressAT2G29060-
ATTED-IIAT2G29060-
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G29060.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G29060
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0053150.0AC005315.3 Arabidopsis thaliana chromosome 2 clone T9I4 map mi54, complete sequence.
GenBankCP0026850.0CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_180470.20.0scarecrow-like protein 34
SwissprotP0C8830.0SCL33_ARATH; Scarecrow-like protein 33
TrEMBLD7LKB70.0D7LKB7_ARALL; Scarecrow transcription factor family protein
STRINGAT2G29060.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP26615129
MalvidsOGEM35827189
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Bolle C
    The role of GRAS proteins in plant signal transduction and development.
    Planta, 2004. 218(5): p. 683-92
    [PMID:14760535]
  3. Tian C,Wan P,Sun S,Li J,Chen M
    Genome-wide analysis of the GRAS gene family in rice and Arabidopsis.
    Plant Mol. Biol., 2004. 54(4): p. 519-32
    [PMID:15316287]
  4. Gao MJ,Parkin I,Lydiate D,Hannoufa A
    An auxin-responsive SCARECROW-like transcriptional activator interacts with histone deacetylase.
    Plant Mol. Biol., 2004. 55(3): p. 417-31
    [PMID:15604690]
  5. Lorkovic ZJ,Lehner R,Forstner C,Barta A
    Evolutionary conservation of minor U12-type spliceosome between plants and humans.
    RNA, 2005. 11(7): p. 1095-107
    [PMID:15987817]
  6. Lee MH, et al.
    Large-scale analysis of the GRAS gene family in Arabidopsis thaliana.
    Plant Mol. Biol., 2008. 67(6): p. 659-70
    [PMID:18500650]