PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G28700.1
Common NameAGL46
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family M-type_MADS
Protein Properties Length: 329aa    MW: 38020.1 Da    PI: 5.6202
Description AGAMOUS-like 46
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G28700.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF29.97.4e-101150342
                 --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
       SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
                 i n++ r+ +f +Rr+g lKK + L vLCd++++ +++ +
  AT2G28700.1 11 IFNDRMRKRSFKQRREGFLKKLNDLKVLCDVNACAVVYNP 50
                 669999*****************************99965 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.9E-12160IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.35E-19183IPR002100Transcription factor, MADS-box
PROSITE profilePS5006614.549149IPR002100Transcription factor, MADS-box
CDDcd002662.34E-28285No hitNo description
PfamPF003191.6E-101150IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009089anatomyendosperm
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
MARKKLNLTY IFNDRMRKRS FKQRREGFLK KLNDLKVLCD VNACAVVYNP FNSNPDVWPS  60
KSEVNNIIKK FEMLPETQKK VKSVNHEEFL NLYISKVEKQ SKKLIVENKE TCLKEVMFKC  120
LGGNMGDFVM NDNDRLDLCK FIDHYLRNLY HHKNVTLNNP NFEIGESSSL MDMAPTATTG  180
NMATTVVDEG MTPLLIAEGS SSSFLNSPLF NSPQLTNELQ LIVSQNHRLE NSLASNLFFS  240
EGQDICIPDM NQSIIPSNQG AEHVDFLESN FLPNNNQEVY IPVMDQDEVY NPNQNHYENQ  300
QGFIDEMMKY AEKTSFPWMV ENHCYNHNQ
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible263444_at0.0
Expression AtlasAT2G28700-
AtGenExpressAT2G28700-
ATTED-IIAT2G28700-
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G28700.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G28700
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY2912060.0AY291206.2 Arabidopsis thaliana hypothetical protein At2g28700 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_180438.20.0AGAMOUS-like 46
TrEMBLA0A178VYD30.0A0A178VYD3_ARATH; AGL46
TrEMBLF4IIT60.0F4IIT6_ARATH; AGAMOUS-like 46
STRINGAT2G28700.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7028415
Representative plantOGRP11413173
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. De Bodt S, et al.
    Genomewide structural annotation and evolutionary analysis of the type I MADS-box genes in plants.
    J. Mol. Evol., 2003. 56(5): p. 573-86
    [PMID:12698294]
  3. Parenicov√° L, et al.
    Molecular and phylogenetic analyses of the complete MADS-box transcription factor family in Arabidopsis: new openings to the MADS world.
    Plant Cell, 2003. 15(7): p. 1538-51
    [PMID:12837945]
  4. Kofuji R, et al.
    Evolution and divergence of the MADS-box gene family based on genome-wide expression analyses.
    Mol. Biol. Evol., 2003. 20(12): p. 1963-77
    [PMID:12949148]
  5. de Folter S, et al.
    Comprehensive interaction map of the Arabidopsis MADS Box transcription factors.
    Plant Cell, 2005. 17(5): p. 1424-33
    [PMID:15805477]
  6. Willems G, et al.
    The genetic basis of zinc tolerance in the metallophyte Arabidopsis halleri ssp. halleri (Brassicaceae): an analysis of quantitative trait loci.
    Genetics, 2007. 176(1): p. 659-74
    [PMID:17409091]
  7. Bemer M,Heijmans K,Airoldi C,Davies B,Angenent GC
    An atlas of type I MADS box gene expression during female gametophyte and seed development in Arabidopsis.
    Plant Physiol., 2010. 154(1): p. 287-300
    [PMID:20631316]