PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G28610.1
Common NamePRS, PRS1, T8O18.10, WOX3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family WOX
Protein Properties Length: 244aa    MW: 28134.3 Da    PI: 9.5278
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G28610.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox62.27.6e-20666257
                 T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
     Homeobox  2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                 ++R+++t+eql +Lee++++  r+p+a ++++++++l    +++ ++V++WFqN++a++++
  AT2G28610.1  6 STRWCPTPEQLMILEEMYRSgIRTPNAVQIQQITAHLafygRIEGKNVFYWFQNHKARDRQ 66
                 58*****************99*************************************996 PP

2Wus_type_Homeobox120.28.9e-39567264
  Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64
                       a+tRW+PtpeQ++iLee+y+sG+rtPn+ +iq+ita+L+ yG+ie+kNVfyWFQN+kaR+rqk
        AT2G28610.1  5 ASTRWCPTPEQLMILEEMYRSGIRTPNAVQIQQITAHLAFYGRIEGKNVFYWFQNHKARDRQK 67
                       589***********************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003890.0013471IPR001356Homeobox domain
SuperFamilySSF466896.42E-11766IPR009057Homeodomain-like
CDDcd000861.03E-4767No hitNo description
PfamPF000461.6E-17766IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.604.5E-7866IPR009057Homeodomain-like
PROSITE profilePS500719.7661267IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008283Biological Processcell proliferation
GO:0009908Biological Processflower development
GO:0009943Biological Processadaxial/abaxial axis specification
GO:0009947Biological Processcentrolateral axis specification
GO:0010865Biological Processstipule development
GO:0030154Biological Processcell differentiation
GO:0048513Biological Processanimal organ development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000015anatomycotyledon primordium
PO:0000017anatomyvascular leaf primordium
PO:0000021anatomypetal primordium
PO:0000037anatomyshoot apex
PO:0000054anatomypetal vascular system
PO:0000229anatomyflower meristem
PO:0004704anatomysepal primordium
PO:0004705anatomystamen primordium
PO:0005021anatomysepal margin
PO:0006504anatomyleaf trichome
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0020128anatomyleaf margin
PO:0025022anatomycollective leaf structure
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 244 aa     Download sequence    Send to blast
MSPVASTRWC PTPEQLMILE EMYRSGIRTP NAVQIQQITA HLAFYGRIEG KNVFYWFQNH  60
KARDRQKLRK KLAKQLHQQQ HQLQLQLQQI KPKPISSMIS QPVNKNIIDH HNPYHHHHHN  120
HHHNHHRPYD HMSFDCCSHP SPMCLPHQGT GVGEAPSKVM NEYYCTKSGA EEILMQKSIT  180
GPNSSYGRDW MMMMDMGPRP SYPSSSSSPI SCCNMMMSSP KIPLKTLELF PISSINSKQD  240
STKL
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible263434_at0.0
Expression AtlasAT2G28610-
AtGenExpressAT2G28610-
ATTED-IIAT2G28610-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: First expressed in the L1 cells of the lateral regions of a flower primordium at early stage 1, in which the lateral sepals are expected to develop at a later stage. It then rapidly decreases at the late stage 1 and disappears at stage 2. At stage 3, it reappears in all four-sepal young primordia. Not detected at the central zone of the inflorescence meristem and the floral meristem. In stages 4 through 6, when four sepals develop to enclose the flower bud, it is localized at the lateral edges of the four sepals and forms an arch of the L1 cells at the margin of sepals. Expressed in the young primordia of petals and stamens. As the petals and stamens develop, it is limited at the margins of petals and stamens in a way similar to that of sepals. In the vegetative phase, it is expressed at the lateral regions of young leaf primordia, as well as in flowers and floral organs. {ECO:0000269|PubMed:11751640, ECO:0000269|PubMed:14711878}.
UniprotTISSUE SPECIFICITY: Expressed in aerial parts of seedlings, inflorescences and flowers at low level. Expressed in a restricted number of L1 cells at the lateral regions of flower primordia. {ECO:0000269|PubMed:11751640}.
Functional Description ? help Back to Top
Source Description
TAIREncodes a homeodomain containing protein that regulates lateral axis-dependent development of Arabidopsis flowers and is required for cell proliferation. It is expressed in a restricted number of L1 cells at the lateral regions of flower primordia, floral organ primordia, and young leaf primordia.
UniProtProbable transcription factor required to initiate organ founder cells in a lateral domain of shoot meristems. Involved in the lateral sepal axis-dependent development of flowers, probably by regulating the proliferation of L1 cells at the lateral region of flower primordia. Required for the formation of the margin cells of the first and second whorl organs. {ECO:0000269|PubMed:11751640, ECO:0000269|PubMed:15169755}.
Function -- GeneRIF ? help Back to Top
  1. Specific expression of PRS and WOX1 in a domain between the adaxial and abaxial domains is important for lateral-specific blade outgrowth and margin-specific cell fate.
    [PMID: 22374393]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G28610.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source Target Gene (A: Activate/R: Repress)
ATRM AT4G00180(R)
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G28610
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY2513970.0AY251397.1 Arabidopsis thaliana PRS/WOX3 protein mRNA, complete cds.
GenBankAB0589200.0AB058920.1 Arabidopsis thaliana PRS mRNA for PRESSED FLOWER, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_180429.10.0protein PRESSED FLOWER
SwissprotQ9SIB40.0WOX3_ARATH; WUSCHEL-related homeobox 3
TrEMBLA0MEQ60.0A0MEQ6_ARATH; Putative uncharacterized protein (Fragment)
TrEMBLQ1PEZ20.0Q1PEZ2_ARATH; Homeobox-leucine zipper transcription factor
STRINGAT2G28610.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP55801121
MalvidsOGEM74802642
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Matsumoto N,Okada K
    A homeobox gene, PRESSED FLOWER, regulates lateral axis-dependent development of Arabidopsis flowers.
    Genes Dev., 2001. 15(24): p. 3355-64
    [PMID:11751640]
  3. Haecker A, et al.
    Expression dynamics of WOX genes mark cell fate decisions during early embryonic patterning in Arabidopsis thaliana.
    Development, 2004. 131(3): p. 657-68
    [PMID:14711878]
  4. Nardmann J,Ji J,Werr W,Scanlon MJ
    The maize duplicate genes narrow sheath1 and narrow sheath2 encode a conserved homeobox gene function in a lateral domain of shoot apical meristems.
    Development, 2004. 131(12): p. 2827-39
    [PMID:15169755]
  5. Dai M,Hu Y,Zhao Y,Liu H,Zhou DX
    A WUSCHEL-LIKE HOMEOBOX gene represses a YABBY gene expression required for rice leaf development.
    Plant Physiol., 2007. 144(1): p. 380-90
    [PMID:17351053]
  6. Shimizu R, et al.
    Tissue specificity and evolution of meristematic WOX3 function.
    Plant Physiol., 2009. 149(2): p. 841-50
    [PMID:19073779]
  7. Karim MR,Hirota A,Kwiatkowska D,Tasaka M,Aida M
    A role for Arabidopsis PUCHI in floral meristem identity and bract suppression.
    Plant Cell, 2009. 21(5): p. 1360-72
    [PMID:19482972]
  8. Dai M,Hu Y,Zhao Y,Zhou DX
    Regulatory Networks Involving YABBY Genes in Rice Shoot Development.
    Plant Signal Behav, 2007. 2(5): p. 399-400
    [PMID:19704613]
  9. Vandenbussche M, et al.
    Differential recruitment of WOX transcription factors for lateral development and organ fusion in Petunia and Arabidopsis.
    Plant Cell, 2009. 21(8): p. 2269-83
    [PMID:19717616]
  10. Ji J,Shimizu R,Sinha N,Scanlon MJ
    Analyses of WOX4 transgenics provide further evidence for the evolution of the WOX gene family during the regulation of diverse stem cell functions.
    Plant Signal Behav, 2010. 5(7): p. 916-20
    [PMID:20495368]
  11. Hirakawa Y,Kondo Y,Fukuda H
    TDIF peptide signaling regulates vascular stem cell proliferation via the WOX4 homeobox gene in Arabidopsis.
    Plant Cell, 2010. 22(8): p. 2618-29
    [PMID:20729381]
  12. Zhang X,Zong J,Liu J,Yin J,Zhang D
    Genome-wide analysis of WOX gene family in rice, sorghum, maize, Arabidopsis and poplar.
    J Integr Plant Biol, 2010. 52(11): p. 1016-26
    [PMID:20977659]
  13. Nakata M, et al.
    Roles of the middle domain-specific WUSCHEL-RELATED HOMEOBOX genes in early development of leaves in Arabidopsis.
    Plant Cell, 2012. 24(2): p. 519-35
    [PMID:22374393]
  14. Nakata M,Okada K
    The three-domain model: a new model for the early development of leaves in Arabidopsis thaliana.
    Plant Signal Behav, 2012. 7(11): p. 1423-7
    [PMID:22951404]
  15. Cho SH, et al.
    The rice narrow leaf2 and narrow leaf3 loci encode WUSCHEL-related homeobox 3A (OsWOX3A) and function in leaf, spikelet, tiller and lateral root development.
    New Phytol., 2013. 198(4): p. 1071-84
    [PMID:23551229]
  16. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]