PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G28510.1
Common NameDOF2.1, T17D12.7
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family Dof
Protein Properties Length: 288aa    MW: 31782 Da    PI: 8.0376
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G28510.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof121.72.5e-3846105463
       zf-Dof   4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63 
                  +a++cprC+s ntkfCyynnyslsqPryfCk+CrryWtkGG+lrnvPvGgg+r+nk+sss
  AT2G28510.1  46 EAQNCPRCESPNTKFCYYNNYSLSQPRYFCKSCRRYWTKGGTLRNVPVGGGCRRNKRSSS 105
                  5789****************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074787.0E-234697IPR003851Zinc finger, Dof-type
PfamPF027011.5E-3247102IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.97548102IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105086IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005730Cellular Componentnucleolus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046872Molecular Functionmetal ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 288 aa     Download sequence    Send to blast
MDPEQEISNE TLETILVSST KGSNNNNKKM EEEMKKKVSR GELGGEAQNC PRCESPNTKF  60
CYYNNYSLSQ PRYFCKSCRR YWTKGGTLRN VPVGGGCRRN KRSSSSAFSK NNNNKSINFH  120
TDPLQNPLIT GMPPSSFGYD HSIDLNLAFA TLQKHHLSSQ ATTPSFGFGG DLSIYGNSTN  180
DVGIFGGQNG TYNNSLCYGF MSGNGNNNQN EIKMASTLGM SLEGNERKQE NVNNNNNNSE  240
NPSKVFWGFP WQMTGDSAGV VPEIDPGRES WNGMVSSWNN GLLNTPLV
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.283590.0root| silique
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO179793820.0
Genevisible264056_at0.0
Expression AtlasAT2G28510-
AtGenExpressAT2G28510-
ATTED-IIAT2G28510-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed at preprocambial stages first in wide domains, and later confined to sites of vein development. {ECO:0000269|PubMed:20563990}.
UniprotTISSUE SPECIFICITY: Accumulates in the stele. {ECO:0000269|PubMed:20563990}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. {ECO:0000250}.
Function -- GeneRIF ? help Back to Top
  1. Data show that the expression of 3 DOF genes DOF2.1 (At2g28510), DOF4.6 (At4g24060) and DOF5.3 (At5g60200) is activated at early vascular development stages overlapping onset of ATHB8 expression.
    [PMID: 20563990]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G28510.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G28510
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0704210.0AY070421.1 Arabidopsis thaliana putative DOF zinc finger protein (At2g28510) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_565673.10.0Dof-type zinc finger DNA-binding family protein
SwissprotQ8LE430.0DOF21_ARATH; Dof zinc finger protein DOF2.1
TrEMBLA0A178VVJ90.0A0A178VVJ9_ARATH; Uncharacterized protein
STRINGAT2G28510.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM69602743
Representative plantOGRP3817445
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Yanagisawa S
    The Dof family of plant transcription factors.
    Trends Plant Sci., 2002. 7(12): p. 555-60
    [PMID:12475498]
  3. Ogawa M, et al.
    Gibberellin biosynthesis and response during Arabidopsis seed germination.
    Plant Cell, 2003. 15(7): p. 1591-604
    [PMID:12837949]
  4. Lijavetzky D,Carbonero P,Vicente-Carbajosa J
    Genome-wide comparative phylogenetic analysis of the rice and Arabidopsis Dof gene families.
    BMC Evol. Biol., 2003. 3: p. 17
    [PMID:12877745]
  5. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  6. Pendle AF, et al.
    Proteomic analysis of the Arabidopsis nucleolus suggests novel nucleolar functions.
    Mol. Biol. Cell, 2005. 16(1): p. 260-9
    [PMID:15496452]
  7. Gardiner J,Sherr I,Scarpella E
    Expression of DOF genes identifies early stages of vascular development in Arabidopsis leaves.
    Int. J. Dev. Biol., 2010. 54(8-9): p. 1389-96
    [PMID:20563990]