PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G28340.1
Common NameGATA13, T1B3.14
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family GATA
Protein Properties Length: 291aa    MW: 33017.5 Da    PI: 9.8948
Description GATA transcription factor 13
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G28340.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA62.26e-20193227135
         GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                  C++C tt+Tp+WR+gp+g ktLCnaCG+++r+ +l
  AT2G28340.1 193 CTHCETTTTPQWREGPNGRKTLCNACGIRFRSGRL 227
                  *******************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF577168.55E-14186248No hitNo description
SMARTSM004015.0E-18187241IPR000679Zinc finger, GATA-type
PROSITE profilePS5011412.73187223IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.103.9E-15192224IPR013088Zinc finger, NHR/GATA-type
PROSITE patternPS003440193218IPR000679Zinc finger, GATA-type
CDDcd002021.34E-17193249No hitNo description
PfamPF003209.0E-18193227IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0030154Biological Processcell differentiation
GO:0045944Biological Processpositive regulation of transcription from RNA polymerase II promoter
GO:0005634Cellular Componentnucleus
GO:0005667Cellular Componenttranscription factor complex
GO:0000977Molecular FunctionRNA polymerase II regulatory region sequence-specific DNA binding
GO:0001085Molecular FunctionRNA polymerase II transcription factor binding
GO:0001228Molecular Functiontranscriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding
GO:0003682Molecular Functionchromatin binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    Send to blast
MNNDLWLPEE DFKGLPDNFL DNLVDPTNDV SVEDIETGDD EGDWDAKFQK LVPPPLDELM  60
SLSYEFTCNG QRVQVQKHVP ILKQSSSSEV FSTVDNSPPN VKVSKLLQSL SPVSVLKNTN  120
GSGSPQNPNG DQKLAFLVKG IRSKRKRPTL LRVTFLKSFL LEMSQQFAPD ESESSEISAL  180
KKRKKNKSRR LKCTHCETTT TPQWREGPNG RKTLCNACGI RFRSGRLVLE YRPAASPTFI  240
PTVHSNLHKK IIYMRMKDND QFDTRKIRAE TSGPETRSRL RNFGRPMSYG Q
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1179186LKKRKKNK
2180184KKRKK
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO3341845310.0
Expression AtlasAT2G28340-
AtGenExpressAT2G28340-
Functional Description ? help Back to Top
Source Description
TAIREncodes a member of the GATA factor family of zinc finger transcription factors.
UniProtTranscriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes (By similarity). {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G28340.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G28340
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0062830.0AC006283.6 Arabidopsis thaliana chromosome 2 clone T1B3 map mi54, complete sequence.
GenBankCP0026850.0CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_180401.20.0GATA transcription factor 13
SwissprotQ9SKN60.0GAT13_ARATH; Putative GATA transcription factor 13
TrEMBLD7LHN71e-150D7LHN7_ARALL; Putative uncharacterized protein
STRINGAT2G28340.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6817287
MalvidsOGEM16812589
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Jeong MJ,Jeong MJ,Shih MC
    Interaction of a GATA factor with cis-acting elements involved in light regulation of nuclear genes encoding chloroplast glyceraldehyde-3-phosphate dehydrogenase in Arabidopsis.
    Biochem. Biophys. Res. Commun., 2003. 300(2): p. 555-62
    [PMID:12504119]
  3. Reyes JC,Muro-Pastor MI,Florencio FJ
    The GATA family of transcription factors in Arabidopsis and rice.
    Plant Physiol., 2004. 134(4): p. 1718-32
    [PMID:15084732]
  4. Bi YM, et al.
    Genetic analysis of Arabidopsis GATA transcription factor gene family reveals a nitrate-inducible member important for chlorophyll synthesis and glucose sensitivity.
    Plant J., 2005. 44(4): p. 680-92
    [PMID:16262716]
  5. Ditt RF, et al.
    The Arabidopsis thaliana transcriptome in response to Agrobacterium tumefaciens.
    Mol. Plant Microbe Interact., 2006. 19(6): p. 665-81
    [PMID:16776300]
  6. Manfield IW,Devlin PF,Jen CH,Westhead DR,Gilmartin PM
    Conservation, convergence, and divergence of light-responsive, circadian-regulated, and tissue-specific expression patterns during evolution of the Arabidopsis GATA gene family.
    Plant Physiol., 2007. 143(2): p. 941-58
    [PMID:17208962]