PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G27990.1
Common NameBLH8, PNF, T1E2.9
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family TALE
Protein Properties Length: 584aa    MW: 65775.4 Da    PI: 8.2483
Description BEL1-like homeodomain 8
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G27990.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox30.27.4e-104494812254
                  SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
     Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                  ++yp+ ++++ LA+++gL+ +qV++WF N R +
  AT2G27990.1 449 HPYPTDSDKQMLATQTGLSRNQVSNWFINARVR 481
                  89*****************************88 PP

2BELL102.23.7e-33319387472
         BELL   4 elqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                  +++ kkakLl l+eeV+k+Yk y++qlqtv+ssF++vagl++a+pY+slAlk++Sr+F++L++aiae++
  AT2G27990.1 319 KNRLKKAKLLFLQEEVCKWYKLYNHQLQTVMSSFNTVAGLNTATPYISLALKRTSRSFKALRTAIAEHV 387
                  5789**************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.4E-63257385IPR006563POX domain
PfamPF075266.0E-28262384IPR006563POX domain
PROSITE profilePS5007112.017422485IPR001356Homeobox domain
SMARTSM003891.4E-10425489IPR001356Homeobox domain
CDDcd000862.74E-11425486No hitNo description
SuperFamilySSF466896.42E-17427491IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.0E-27428489IPR009057Homeodomain-like
PfamPF059201.5E-18442481IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010076Biological Processmaintenance of floral meristem identity
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010223Biological Processsecondary shoot formation
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0010229Biological Processinflorescence development
GO:0048645Biological Processorgan formation
GO:0080006Biological Processinternode patterning
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000037anatomyshoot apex
PO:0000229anatomyflower meristem
PO:0000230anatomyinflorescence meristem
PO:0008016anatomyvegetative shoot apical meristem
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0020100anatomyhypocotyl
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 584 aa     Download sequence    Send to blast
MDMIKPDFQQ IRRDKFRVEQ MNDFPNTWTQ QQHQNIRIPN NLDLIGILQN QISVPVQTDL  60
YQDSAATFMN MPQSIHRDPQ GPSNWRISDL SQPSTVNHGY DQAGIRPNNV ADLLSDHFSS  120
RNQILDRPLY VGRDSIPQSS MIRRSEVSCL DDNQKGCVTV ACSGTGNEIL RSSYDQGSSS  180
GSYRGEFSFL PSLENQSVAH NASNWNHGPV NVTATSHTNS KKGFPLSLLS DIPPSRDVGN  240
AAVLSTMNIH GPLGPFTGYA SILKSSRFLE PAQKMLEEFC ISYASKIISR SESTSMEDDD  300
DDDDNLSGFS SSSEPLEPKN RLKKAKLLFL QEEVCKWYKL YNHQLQTVMS SFNTVAGLNT  360
ATPYISLALK RTSRSFKALR TAIAEHVKQI SSHSSNGNNN NRFQKRQRSL IGNNVGFESQ  420
QQHIWRPQRG LPERAVAVLR AWLFDHFLHP YPTDSDKQML ATQTGLSRNQ VSNWFINARV  480
RLWKPMVEEI HTLETKAIKN ADTSHNIEPS NRPNTVSSPS HEQTLTGLSG TKRSRLEYMD  540
MVGFNRGNVS LTLELRRGVD NVIQTQTQDH QFGTGSQMFH DFVG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_B2e-15431489563Homeobox protein Meis2
3k2a_A2e-15431489563Homeobox protein Meis2
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible264068_at0.0
Expression AtlasAT2G27990-
AtGenExpressAT2G27990-
ATTED-IIAT2G27990-
Functional Description ? help Back to Top
Source Description
TAIREncodes a BEL1-like homeobox gene that functions together with PNY in meristem maintenance by regulating the allocation process during vegetative and reproductive development. Both gene products are required for the competence of the SAM to respond properly to floral inductive signals.
UniProtRequired for specifying floral primordia and establishing early internode patterning events during inflorescence development. {ECO:0000269|PubMed:15120075, ECO:0000269|PubMed:16741748}.
Function -- GeneRIF ? help Back to Top
  1. PNF functions in the inner whorls to regulate flower patterning events.
    [PMID: 19082619]
  2. combined lesions in ATH1, PNY and PNF result in a full phenocopy of shoot apical meristem loss-of-function mutants.
    [PMID: 19175771]
  3. PNY and PNF act to restrict organogenesis to the peripheral zone by maintaining a boundary between the central zone and peripheral zone.
    [PMID: 21505100]
  4. SPL3, SPL4, and SPL5 function is dependent upon PNY and PNF
    [PMID: 21653282]
  5. Regulation of meristem central zone integrity by PNY and PNF is crucial for vegetative and reproductive development.
    [PMID: 21822063]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G27990.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source Target Gene (A: Activate/R: Repress)
ATRM AT1G26310(A), AT1G69120(A), AT5G61850(A)
Interaction ? help Back to Top
Source Intact With
BioGRIDAT4G08150, AT1G70510
IntActSearch Q9SJJ3
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G27990
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1191530.0AK119153.1 Arabidopsis thaliana At2g27990 mRNA for putative homeodomain transcription factor, complete cds, clone: RAFL21-50-D24.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_180366.10.0BEL1-like homeodomain 8
SwissprotQ9SJJ30.0BLH8_ARATH; BEL1-like homeodomain protein 8
TrEMBLD7LIG60.0D7LIG6_ARALL; Putative uncharacterized protein
STRINGAT2G27990.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP13316172
MalvidsOGEM143211520
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Seki M, et al.
    Functional annotation of a full-length Arabidopsis cDNA collection.
    Science, 2002. 296(5565): p. 141-5
    [PMID:11910074]
  3. Byrne ME,Groover AT,Fontana JR,Martienssen RA
    Phyllotactic pattern and stem cell fate are determined by the Arabidopsis homeobox gene BELLRINGER.
    Development, 2003. 130(17): p. 3941-50
    [PMID:12874117]
  4. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  5. Bhatt AM,Etchells JP,Canales C,Lagodienko A,Dickinson H
    VAAMANA--a BEL1-like homeodomain protein, interacts with KNOX proteins BP and STM and regulates inflorescence stem growth in Arabidopsis.
    Gene, 2004. 328: p. 103-11
    [PMID:15019989]
  6. Smith HM,Campbell BC,Hake S
    Competence to respond to floral inductive signals requires the homeobox genes PENNYWISE and POUND-FOOLISH.
    Curr. Biol., 2004. 14(9): p. 812-7
    [PMID:15120075]
  7. Hackbusch J,Richter K,Müller J,Salamini F,Uhrig JF
    A central role of Arabidopsis thaliana ovate family proteins in networking and subcellular localization of 3-aa loop extension homeodomain proteins.
    Proc. Natl. Acad. Sci. U.S.A., 2005. 102(13): p. 4908-12
    [PMID:15781858]
  8. Kanrar S,Onguka O,Smith HM
    Arabidopsis inflorescence architecture requires the activities of KNOX-BELL homeodomain heterodimers.
    Planta, 2006. 224(5): p. 1163-73
    [PMID:16741748]
  9. Kanrar S,Bhattacharya M,Arthur B,Courtier J,Smith HM
    Regulatory networks that function to specify flower meristems require the function of homeobox genes PENNYWISE and POUND-FOOLISH in Arabidopsis.
    Plant J., 2008. 54(5): p. 924-37
    [PMID:18298668]
  10. Li Y, et al.
    Genome-wide identification of osmotic stress response gene in Arabidopsis thaliana.
    Genomics, 2008. 92(6): p. 488-93
    [PMID:18804526]
  11. Yu L,Patibanda V,Smith HM
    A novel role of BELL1-like homeobox genes, PENNYWISE and POUND-FOOLISH, in floral patterning.
    Planta, 2009. 229(3): p. 693-707
    [PMID:19082619]
  12. Jackson SD
    Plant responses to photoperiod.
    New Phytol., 2009. 181(3): p. 517-31
    [PMID:19154317]
  13. Rutjens B, et al.
    Shoot apical meristem function in Arabidopsis requires the combined activities of three BEL1-like homeodomain proteins.
    Plant J., 2009. 58(4): p. 641-54
    [PMID:19175771]
  14. Smith HM,Ung N,Lal S,Courtier J
    Specification of reproductive meristems requires the combined function of SHOOT MERISTEMLESS and floral integrators FLOWERING LOCUS T and FD during Arabidopsis inflorescence development.
    J. Exp. Bot., 2011. 62(2): p. 583-93
    [PMID:20937733]
  15. Ung N,Lal S,Smith HM
    The role of PENNYWISE and POUND-FOOLISH in the maintenance of the shoot apical meristem in Arabidopsis.
    Plant Physiol., 2011. 156(2): p. 605-14
    [PMID:21505100]
  16. Lal S,Pacis LB,Smith HM
    Regulation of the SQUAMOSA PROMOTER-BINDING PROTEIN-LIKE genes/microRNA156 module by the homeodomain proteins PENNYWISE and POUND-FOOLISH in Arabidopsis.
    Mol Plant, 2011. 4(6): p. 1123-32
    [PMID:21653282]
  17. Arabidopsis Interactome Mapping Consortium
    Evidence for network evolution in an Arabidopsis interactome map.
    Science, 2011. 333(6042): p. 601-7
    [PMID:21798944]
  18. Ung N,Smith HM
    Regulation of shoot meristem integrity during Arabidopsis vegetative development.
    Plant Signal Behav, 2011. 6(8): p. 1250-2
    [PMID:21822063]
  19. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]