PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G27300.1
Common NameANAC040, F12K2.12, NTL8
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NAC
Protein Properties Length: 335aa    MW: 38183.9 Da    PI: 6.2761
Description NTM1-like 8
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G27300.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM157.17.3e-49141401128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkg 97 
                  l pGfrF+Ptd el+++yL++k++g+++++  vi+ev+iyk+ePwdLp ++  ++e+ew++F+ r +ky++g++++rat+ gyWkatgk+++v+s ++
  AT2G27300.1  14 LFPGFRFSPTDVELISYYLRRKIDGDENSV-AVIAEVEIYKFEPWDLPeESKLKSENEWFYFCARGRKYPHGSQSRRATQLGYWKATGKERSVKS-GN 109
                  579************************999.89***************433334678**************************************.99 PP

          NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                  ++vg+k+tLvf+ grap+ge+t+W+mhey +
  AT2G27300.1 110 QVVGTKRTLVFHIGRAPRGERTEWIMHEYCI 140
                  9****************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019419.15E-556155IPR003441NAC domain
PROSITE profilePS5100552.47314156IPR003441NAC domain
PfamPF023652.6E-2416139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009845Biological Processseed germination
GO:0009908Biological Processflower development
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0033619Biological Processmembrane protein proteolysis
GO:0048573Biological Processphotoperiodism, flowering
GO:0071472Biological Processcellular response to salt stress
GO:0005634Cellular Componentnucleus
GO:0005886Cellular Componentplasma membrane
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000001anatomyplant embryo proper
PO:0000013anatomycauline leaf
PO:0009015anatomyportion of vascular tissue
PO:0009047anatomystem
PO:0009049anatomyinflorescence
Sequence ? help Back to Top
Protein Sequence    Length: 335 aa     Download sequence    Send to blast
MSKEAEMSIA VSALFPGFRF SPTDVELISY YLRRKIDGDE NSVAVIAEVE IYKFEPWDLP  60
EESKLKSENE WFYFCARGRK YPHGSQSRRA TQLGYWKATG KERSVKSGNQ VVGTKRTLVF  120
HIGRAPRGER TEWIMHEYCI HGAPQDALVV CRLRKNADFR ASSTQKMEDG VVQDDGYVGQ  180
RGGLEKEDKS YYESEHQIPN GDIAESSNVV EDQADTDDDC YAEILNDDII KLDEEALKAS  240
QAFRPTNPTH QETISSESSS KRSKCGIKKE STETMNCYAL FRIKNVAGTD SSWRFPNPFK  300
IKKDDSQRLM KNVLATTVFL AILFSFFWTV LIARN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A5e-43413810138Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO184013850.0
Genevisible265621_at0.0
Expression AtlasAT2G27300-
AtGenExpressAT2G27300-
ATTED-IIAT2G27300-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Accumulates in imbibed seeds (PubMed:19704545). Detected in early stages of seed development, especially in the basal tip of immature embryo. Particularly expressed in vascular tissues of inflorescence stems, roots, leaves and petioles (PubMed:17410378). {ECO:0000269|PubMed:17410378, ECO:0000269|PubMed:19704545}.
UniprotTISSUE SPECIFICITY: Expressed in seeds, leaves, roots and inflorescence (PubMed:17410378). Expressed in roots, rosette leaves, cauline leaves, shoot apex, stems and flowers (PubMed:17158162). {ECO:0000269|PubMed:17158162, ECO:0000269|PubMed:17410378}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP), probably via metalloprotease activity. Regulates gibberellic acid-mediated salt-responsive repression of seed germination and flowering via FT, thus delaying seed germination under high salinity conditions. {ECO:0000269|PubMed:17410378, ECO:0000269|PubMed:18363782, ECO:0000269|PubMed:19704528, ECO:0000269|PubMed:19704545}.
Function -- GeneRIF ? help Back to Top
  1. NTL8 mediates salt-responsive flowering via FT in Arabidopsis.
    [PMID: 17410378]
  2. modulates gibberellic acid-mediated salt signaling in regulating seed germination
    [PMID: 18363782]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00280DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G27300.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By high salt stress (PubMed:19704545, PubMed:17410378, PubMed:18363782, PubMed:19704528). Repressed by gibberellic acid (GA), but induced by the GA biosynthetic inhibitor paclabutrazol (PAC) (PubMed:18363782). Accumulates transiently in seeds upon imbibition (PubMed:19704545, PubMed:17410378, PubMed:18363782, PubMed:19704528). Induced by drought stress (PubMed:17158162). {ECO:0000269|PubMed:17158162, ECO:0000269|PubMed:17410378, ECO:0000269|PubMed:18363782, ECO:0000269|PubMed:19704528, ECO:0000269|PubMed:19704545}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Upstream Regulators) ? help Back to Top
Source Upstream Regulator (A: Activate/R: Repress)
ATRM AT3G03450 (A)
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source Target Gene (A: Activate/R: Repress)
ATRM AT1G65480(R)
Phenotype -- Disruption Phenotype ? help Back to Top
Source Description
UniProtDISRUPTION PHENOTYPE: In ntl8-1, no discernible phenotypic changes except slight differences in lateral root growth and flowering time, as well as reduced lateral root growth rate. Insensitive to high salt. {ECO:0000269|PubMed:17410378, ECO:0000269|PubMed:18363782, ECO:0000269|PubMed:19704545}.
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G27300
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ0565440.0DQ056544.1 Arabidopsis thaliana no apical meristem family protein (At2g27300) mRNA, complete cds.
GenBankBT0289340.0BT028934.1 Arabidopsis thaliana At2g27300 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_180298.10.0protein NTM1-like 8
SwissprotQ9XIN70.0NAC40_ARATH; NAC domain-containing protein 40
TrEMBLR0HQ770.0R0HQ77_9BRAS; Uncharacterized protein
STRINGAT2G27300.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP10249610
MalvidsOGEM104532533
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Ooka H, et al.
    Comprehensive analysis of NAC family genes in Oryza sativa and Arabidopsis thaliana.
    DNA Res., 2003. 10(6): p. 239-47
    [PMID:15029955]
  3. Kim YS, et al.
    A membrane-bound NAC transcription factor regulates cell division in Arabidopsis.
    Plant Cell, 2006. 18(11): p. 3132-44
    [PMID:17098812]
  4. Kim SY, et al.
    Exploring membrane-associated NAC transcription factors in Arabidopsis: implications for membrane biology in genome regulation.
    Nucleic Acids Res., 2007. 35(1): p. 203-13
    [PMID:17158162]
  5. Kim SG,Kim SY,Park CM
    A membrane-associated NAC transcription factor regulates salt-responsive flowering via FLOWERING LOCUS T in Arabidopsis.
    Planta, 2007. 226(3): p. 647-54
    [PMID:17410378]
  6. Kim SG,Lee AK,Yoon HK,Park CM
    A membrane-bound NAC transcription factor NTL8 regulates gibberellic acid-mediated salt signaling in Arabidopsis seed germination.
    Plant J., 2008. 55(1): p. 77-88
    [PMID:18363782]
  7. Kim SG,Park CM
    Gibberellic acid-mediated salt signaling in seed germination.
    Plant Signal Behav, 2008. 3(10): p. 877-9
    [PMID:19704528]
  8. Kim SG,Park CM
    Membrane-mediated salt stress signaling in flowering time control.
    Plant Signal Behav, 2007. 2(6): p. 517-8
    [PMID:19704545]
  9. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]