PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G27220.2
Common NameBLH5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family TALE
Protein Properties Length: 439aa    MW: 49853 Da    PI: 8.4206
Description BEL1-like homeodomain 5
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G27220.2genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.62.4e-092562941955
                  HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
     Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                  Fe   ++yp   ++  LAk++gLt++qV++WF N R ++
  AT2G27220.2 256 FEHflHPYPRDLDKVMLAKQTGLTKSQVSNWFINARVRM 294
                  5544589*****************************986 PP

2BELL89.82.8e-291522071772
         BELL  17 eeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                   +V++rYkqy++q+qt+issFe++aglgsa++Yt++Al++iS++Fr++kd+i+ qi
  AT2G27220.2 152 TQVEQRYKQYHDQMQTIISSFEQAAGLGSANSYTHMALQTISKQFRAVKDMISLQI 207
                  58***************************************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005747.8E-5861205IPR006563POX domain
PfamPF075263.5E-3072204IPR006563POX domain
PROSITE profilePS5007112.115234297IPR001356Homeobox domain
SMARTSM003891.2E-8237301IPR001356Homeobox domain
CDDcd000863.48E-11237297No hitNo description
SuperFamilySSF466891.24E-16238304IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.3E-26240301IPR009057Homeodomain-like
PfamPF059203.0E-17254293IPR008422Homeobox KN domain
PROSITE patternPS000270272295IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009009anatomyplant embryo
PO:0009046anatomyflower
PO:0025022anatomycollective leaf structure
PO:0004507developmental stageplant embryo bilateral stage
PO:0007611developmental stagepetal differentiation and expansion stage
Sequence ? help Back to Top
Protein Sequence    Length: 439 aa     Download sequence    Send to blast
MREHSSDLFM MTLNPFREQT TTTNAHDDHF YNLCFGSQQY RPRDEVGHIE QGNSSISTFS  60
NGGVFRALAP IYLKAAQELL NEIVNVGNGS HGAKQERPVS KESTIYGVED INGGYKPGVA  120
ALQMKKAKLI SMGEMVSKIG KLIWEMNLVN YTQVEQRYKQ YHDQMQTIIS SFEQAAGLGS  180
ANSYTHMALQ TISKQFRAVK DMISLQIKQI NKLLGQKEFD EQLKKLGKMA HHHSNAWRPQ  240
RGLPEKAVSV LRSWLFEHFL HPYPRDLDKV MLAKQTGLTK SQVSNWFINA RVRMWKPLVE  300
ELYSEEMDIE ESRKGSDRYS TKGSSSKQPY NNTTSNESSN TILPAFRQGF TETETPRQNS  360
SSSCSVVMRF TKQHMNQANF INFNGGFENY HTMDGNSVSL SLGLPHSCDQ TFNNIHFEST  420
SHGTENSAIY SSSTYQIMD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_B2e-15243301563Homeobox protein Meis2
3k2a_A2e-15243301563Homeobox protein Meis2
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible263081_at0.0
Expression AtlasAT2G27220-
AtGenExpressAT2G27220-
ATTED-IIAT2G27220-
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G27220.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
BioGRIDAT4G32040, AT5G25220, AT1G23380, AT1G62990, AT1G70510
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G27220
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ0565430.0DQ056543.1 Arabidopsis thaliana homeodomain-containing protein (At2g27220) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001189615.10.0BEL1-like homeodomain 5
SwissprotQ8S8970.0BLH5_ARATH; BEL1-like homeodomain protein 5
TrEMBLF4IFQ20.0F4IFQ2_ARATH; BEL1-like homeodomain 5
STRINGAT2G27220.20.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP13316172
MalvidsOGEM147491418
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Bhatt AM,Etchells JP,Canales C,Lagodienko A,Dickinson H
    VAAMANA--a BEL1-like homeodomain protein, interacts with KNOX proteins BP and STM and regulates inflorescence stem growth in Arabidopsis.
    Gene, 2004. 328: p. 103-11
    [PMID:15019989]
  3. Hackbusch J,Richter K,Müller J,Salamini F,Uhrig JF
    A central role of Arabidopsis thaliana ovate family proteins in networking and subcellular localization of 3-aa loop extension homeodomain proteins.
    Proc. Natl. Acad. Sci. U.S.A., 2005. 102(13): p. 4908-12
    [PMID:15781858]