PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G27050.1
Common NameAtEIL1, EIL1, T20P8.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family EIL
Protein Properties Length: 584aa    MW: 66495.4 Da    PI: 6.0554
Description ETHYLENE-INSENSITIVE3-like 1
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G27050.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN35178e-158494311354
                  XXXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
         EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsLraWWkek 98 
                  +el+krmw+d+m+lkrlke++ + +  ke  ++ +k+++s+eqarrkkmsraQDgiLkYMlk+mevc+aqGfvYgiipekgkpv+gasd+Lr+WWk+k
  AT2G27050.1  49 DELEKRMWRDKMRLKRLKEQQSK-C--KEG-VDGSKQRQSQEQARRKKMSRAQDGILKYMLKMMEVCKAQGFVYGIIPEKGKPVTGASDNLREWWKDK 142
                  79******************997.5..787.9999*************************************************************** PP

                  XXXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HHHHHHT--TT--.---- CS
         EIN3  99 vefdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelwwgelglskdqgtppyk 196
                  v+fdrngpaai+kyq++n+i++g++++++    ++h+l+elqDTtlgSLLsalmqhcdppqrrfplekgv+pPWWP+G+e+ww++lgl+++qg+ppyk
  AT2G27050.1 143 VRFDRNGPAAIAKYQSENNISGGSNDCNSLVGPTPHTLQELQDTTLGSLLSALMQHCDPPQRRFPLEKGVSPPWWPNGNEEWWPQLGLPNEQGPPPYK 240
                  ****************************99******************************************************************** PP

                  -GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXX..XX...XXXXXXXXXXXXXXXXXXXX.XXX CS
         EIN3 197 kphdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekecatvsah..ss...slrkqspkvtlsceqkedve.gkk 288
                  kphdlkkawkv+vLtavikhmsp+i++ir+l+rqsk+lqdkm+akes+++l+++nqee  +++++++  ++   s++ +s ++ +++ +++dve  +k
  AT2G27050.1 241 KPHDLKKAWKVGVLTAVIKHMSPDIAKIRKLVRQSKCLQDKMTAKESATWLAIINQEEVVARELYPEscPPlssSSSLGSGSLLINDCSEYDVEgFEK 338
                  *******************************************************************65225535555****************9899 PP

                  XXX.XXXXXXXXXX...........................XXXXXXXXXXXXXXXXXXXXX......XXXXXXX.XXXXXXXXXXXXXXXXX CS
         EIN3 289 eskikhvqavktta...........................gfpvvrkrkkkpsesakvsskevsrtcqssqfrgsetelifadknsisqney 354
                  e++  +v+++k +                            +++++rkrk++++ + +v+++++ +tc++ q+++s+++l+f+d++s++++++
  AT2G27050.1 339 EQHGFDVEERKPEIvmmhplasfgvakmqhfpikeevattvNLEFTRKRKQNNDMNVMVMDRSAGYTCENGQCPHSKMNLGFQDRSSRDNHQM 431
                  999999999999889****************************************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048733.9E-13049298No hitNo description
Gene3DG3DSA:1.10.3180.103.2E-75173308IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167689.29E-62177301IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0009873Biological Processethylene-activated signaling pathway
GO:0042742Biological Processdefense response to bacterium
GO:0071281Biological Processcellular response to iron ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000084anatomyplant sperm cell
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025195anatomypollen tube cell
PO:0025281anatomypollen
PO:0001016developmental stageL mature pollen stage
PO:0001017developmental stageM germinated pollen stage
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 584 aa     Download sequence    Send to blast
MMMFNEMGMY GNMDFFSSST SLDVCPLPQA EQEPVVEDVD YTDDEMDVDE LEKRMWRDKM  60
RLKRLKEQQS KCKEGVDGSK QRQSQEQARR KKMSRAQDGI LKYMLKMMEV CKAQGFVYGI  120
IPEKGKPVTG ASDNLREWWK DKVRFDRNGP AAIAKYQSEN NISGGSNDCN SLVGPTPHTL  180
QELQDTTLGS LLSALMQHCD PPQRRFPLEK GVSPPWWPNG NEEWWPQLGL PNEQGPPPYK  240
KPHDLKKAWK VGVLTAVIKH MSPDIAKIRK LVRQSKCLQD KMTAKESATW LAIINQEEVV  300
ARELYPESCP PLSSSSSLGS GSLLINDCSE YDVEGFEKEQ HGFDVEERKP EIVMMHPLAS  360
FGVAKMQHFP IKEEVATTVN LEFTRKRKQN NDMNVMVMDR SAGYTCENGQ CPHSKMNLGF  420
QDRSSRDNHQ MVCPYRDNRL AYGASKFHMG GMKLVVPQQP VQPIDLSGVG VPENGQKMIT  480
ELMAMYDRNV QSNQTPPTLM ENQSMVIDAK AAQNQQLNFN SGNQMFMQQG TNNGVNNRFQ  540
MVFDSTPFDM AAFDYRDDWQ TGAMEGMGKQ QQQQQQQQDV SIWF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4zds_A2e-851763082134Protein ETHYLENE INSENSITIVE 3
4zds_B2e-851763082134Protein ETHYLENE INSENSITIVE 3
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1383388TRKRKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.108090.0root| vegetative tissue
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1453603730.0
Genevisible266302_at0.0
Expression AtlasAT2G27050-
AtGenExpressAT2G27050-
ATTED-IIAT2G27050-
Functional Description ? help Back to Top
Source Description
TAIRethylene-insensitive3-like1 (EIL1)
UniProtProbable transcription factor acting as a positive regulator in the ethylene response pathway. Could bind the primary ethylene response element present in the ETHYLENE-RESPONSE-FACTOR1 promoter. {ECO:0000269|PubMed:9215635, ECO:0000269|PubMed:9851977}.
Function -- GeneRIF ? help Back to Top
  1. Transcription factor EIL1 is required for the second phase but not the first phase of growth inhibition by ethylene in Arabidopsis seedling hypocotyls.
    [PMID: 15466219]
  2. Light induced regulation of gene expression involves stabilization of EIL1 protein.
    [PMID: 17011517]
  3. Data provide evidence that EIN3/EIL1 directly target SID2 to downregulate PAMP defenses.
    [PMID: 19717619]
  4. our studies demonstrate that ethylene similarly regulates EIN3 and EIL1, the two master transcription factors coordinating myriad ethylene responses, and clarify that EIN2 but not MKK9 is required for ethylene-induced EIN3/EIL1 stabilization
    [PMID: 20647342]
  5. EIN3/EIL1 physically interact with FIT, are required for full FIT accumulation, and contribute to full FIT downstream target gene expression.
    [PMID: 21586684]
  6. identify EIN3/EIL1 as a key integration node whose activation requires both jasmonate and ethylene signaling as a common mechanism to integrate diverse signaling pathways in the regulation of plant development and defense
    [PMID: 21737749]
  7. Photo-oxidative stress may increase upon iron deficiency, which is prevented by expression of EIN3/EIL1.
    [PMID: 22212120]
  8. High salinity induces EIN3 and EIL1 protein accumulation and regulates EIL1 dependent gene network.
    [PMID: 25330213]
  9. these data suggest the detailed mechanism of DNA recognition by EIN3 and provide an in-depth view at molecular level for the transcriptional regulation mediated by EIN3.
    [PMID: 26352699]
  10. EIN3/EIL1 and RHD6/RSL1 coordinately enhance root hair initiation by selectively regulating a subset of core root hair genes.
    [PMID: 29233944]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G27050.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source Target Gene (A: Activate/R: Repress)
ATRM AT1G74710(R), AT3G23240(A), AT4G27440(A), AT5G54190(A)
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDethylene
Interaction ? help Back to Top
Source Intact With
BioGRIDAT2G28160, AT4G17880, AT5G46760, AT1G32640
IntActSearch Q9SLH0
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G27050
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0056230.0AC005623.3 Arabidopsis thaliana chromosome 2 clone T20P8 map B68, complete sequence.
GenBankAY0651910.0AY065191.1 Arabidopsis thaliana ethylene-insensitive3-like1 (EIL1) (At2g27050; T20P8.10) mRNA, complete cds.
GenBankBT0033440.0BT003344.1 Arabidopsis thaliana ethylene-insensitive3-like1 (EIL1) (At2g27050) mRNA, complete cds.
GenBankCP0026850.0CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_180273.10.0ETHYLENE-INSENSITIVE3-like 1
SwissprotQ9SLH00.0EIL1_ARATH; ETHYLENE INSENSITIVE 3-like 1 protein
TrEMBLA0A178VP150.0A0A178VP15_ARATH; EIL1
STRINGAT2G27050.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM21352879
Representative plantOGRP5631682
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Waki K,Shibuya K,Yoshioka T,Hashiba T,Satoh S
    Cloning of a cDNA encoding EIN3-like protein (DC-EIL1) and decrease in its mRNA level during senescence in carnation flower tissues.
    J. Exp. Bot., 2001. 52(355): p. 377-9
    [PMID:11283184]
  3. Tieman DM,Ciardi JA,Taylor MG,Klee HJ
    Members of the tomato LeEIL (EIN3-like) gene family are functionally redundant and regulate ethylene responses throughout plant development.
    Plant J., 2001. 26(1): p. 47-58
    [PMID:11359609]
  4. Wang KL,Li H,Ecker JR
    Ethylene biosynthesis and signaling networks.
    Plant Cell, 2002. 14 Suppl: p. S131-51
    [PMID:12045274]
  5. Alonso JM, et al.
    Five components of the ethylene-response pathway identified in a screen for weak ethylene-insensitive mutants in Arabidopsis.
    Proc. Natl. Acad. Sci. U.S.A., 2003. 100(5): p. 2992-7
    [PMID:12606727]
  6. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  7. Guo H,Ecker JR
    Plant responses to ethylene gas are mediated by SCF(EBF1/EBF2)-dependent proteolysis of EIN3 transcription factor.
    Cell, 2003. 115(6): p. 667-77
    [PMID:14675532]
  8. Potuschak T, et al.
    EIN3-dependent regulation of plant ethylene hormone signaling by two arabidopsis F box proteins: EBF1 and EBF2.
    Cell, 2003. 115(6): p. 679-89
    [PMID:14675533]
  9. Chen G,Alexander L,Grierson D
    Constitutive expression of EIL-like transcription factor partially restores ripening in the ethylene-insensitive Nr tomato mutant.
    J. Exp. Bot., 2004. 55(402): p. 1491-7
    [PMID:15181103]
  10. Binder BM,Mortimore LA,Stepanova AN,Ecker JR,Bleecker AB
    Short-term growth responses to ethylene in Arabidopsis seedlings are EIN3/EIL1 independent.
    Plant Physiol., 2004. 136(2): p. 2921-7
    [PMID:15466219]
  11. Chang C,Bleecker AB
    Ethylene biology. More than a gas.
    Plant Physiol., 2004. 136(2): p. 2895-9
    [PMID:15489282]
  12. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  13. Barry CS,Giovannoni JJ
    Ripening in the tomato Green-ripe mutant is inhibited by ectopic expression of a protein that disrupts ethylene signaling.
    Proc. Natl. Acad. Sci. U.S.A., 2006. 103(20): p. 7923-8
    [PMID:16682641]
  14. Lee JH,Deng XW,Kim WT
    Possible role of light in the maintenance of EIN3/EIL1 stability in Arabidopsis seedlings.
    Biochem. Biophys. Res. Commun., 2006. 350(2): p. 484-91
    [PMID:17011517]
  15. Binder BM, et al.
    The Arabidopsis EIN3 binding F-Box proteins EBF1 and EBF2 have distinct but overlapping roles in ethylene signaling.
    Plant Cell, 2007. 19(2): p. 509-23
    [PMID:17307926]
  16. Ascencio-Ib
    Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection.
    Plant Physiol., 2008. 148(1): p. 436-54
    [PMID:18650403]
  17. Wang Y, et al.
    Transcriptome analyses show changes in gene expression to accompany pollen germination and tube growth in Arabidopsis.
    Plant Physiol., 2008. 148(3): p. 1201-11
    [PMID:18775970]
  18. Chen H, et al.
    ETHYLENE INSENSITIVE3 and ETHYLENE INSENSITIVE3-LIKE1 repress SALICYLIC ACID INDUCTION DEFICIENT2 expression to negatively regulate plant innate immunity in Arabidopsis.
    Plant Cell, 2009. 21(8): p. 2527-40
    [PMID:19717619]
  19. Zhong S, et al.
    EIN3/EIL1 cooperate with PIF1 to prevent photo-oxidation and to promote greening of Arabidopsis seedlings.
    Proc. Natl. Acad. Sci. U.S.A., 2009. 106(50): p. 21431-6
    [PMID:19948955]
  20. Camehl I, et al.
    Ethylene signalling and ethylene-targeted transcription factors are required to balance beneficial and nonbeneficial traits in the symbiosis between the endophytic fungus Piriformospora indica and Arabidopsis thaliana.
    New Phytol., 2010. 185(4): p. 1062-73
    [PMID:20085621]
  21. Garc
    Ethylene and nitric oxide involvement in the up-regulation of key genes related to iron acquisition and homeostasis in Arabidopsis.
    J. Exp. Bot., 2010. 61(14): p. 3885-99
    [PMID:20627899]
  22. An F, et al.
    Ethylene-induced stabilization of ETHYLENE INSENSITIVE3 and EIN3-LIKE1 is mediated by proteasomal degradation of EIN3 binding F-box 1 and 2 that requires EIN2 in Arabidopsis.
    Plant Cell, 2010. 22(7): p. 2384-401
    [PMID:20647342]
  23. Boutrot F, et al.
    Direct transcriptional control of the Arabidopsis immune receptor FLS2 by the ethylene-dependent transcription factors EIN3 and EIL1.
    Proc. Natl. Acad. Sci. U.S.A., 2010. 107(32): p. 14502-7
    [PMID:20663954]
  24. Elrouby N,Coupland G
    Proteome-wide screens for small ubiquitin-like modifier (SUMO) substrates identify Arabidopsis proteins implicated in diverse biological processes.
    Proc. Natl. Acad. Sci. U.S.A., 2010. 107(40): p. 17415-20
    [PMID:20855607]
  25. Jeong SW, et al.
    Ethylene suppression of sugar-induced anthocyanin pigmentation in Arabidopsis.
    Plant Physiol., 2010. 154(3): p. 1514-31
    [PMID:20876338]
  26. Lingam S, et al.
    Interaction between the bHLH transcription factor FIT and ETHYLENE INSENSITIVE3/ETHYLENE INSENSITIVE3-LIKE1 reveals molecular linkage between the regulation of iron acquisition and ethylene signaling in Arabidopsis.
    Plant Cell, 2011. 23(5): p. 1815-29
    [PMID:21586684]
  27. Lei G, et al.
    EIN2 regulates salt stress response and interacts with a MA3 domain-containing protein ECIP1 in Arabidopsis.
    Plant Cell Environ., 2011. 34(10): p. 1678-92
    [PMID:21631530]
  28. Zhu Z, et al.
    Derepression of ethylene-stabilized transcription factors (EIN3/EIL1) mediates jasmonate and ethylene signaling synergy in Arabidopsis.
    Proc. Natl. Acad. Sci. U.S.A., 2011. 108(30): p. 12539-44
    [PMID:21737749]
  29. Zhang L, et al.
    An AP2 domain-containing gene, ESE1, targeted by the ethylene signaling component EIN3 is important for the salt response in Arabidopsis.
    Plant Physiol., 2011. 157(2): p. 854-65
    [PMID:21832142]
  30. Bauer P,Blondet E
    Transcriptome analysis of ein3 eil1 mutants in response to iron deficiency.
    Plant Signal Behav, 2011. 6(11): p. 1669-71
    [PMID:22212120]
  31. An F, et al.
    Coordinated regulation of apical hook development by gibberellins and ethylene in etiolated Arabidopsis seedlings.
    Cell Res., 2012. 22(5): p. 915-27
    [PMID:22349459]
  32. Zhao Y, et al.
    Arabidopsis RAP2.2 plays an important role in plant resistance to Botrytis cinerea and ethylene responses.
    New Phytol., 2012. 195(2): p. 450-60
    [PMID:22530619]
  33. Shi Y, et al.
    Ethylene signaling negatively regulates freezing tolerance by repressing expression of CBF and type-A ARR genes in Arabidopsis.
    Plant Cell, 2012. 24(6): p. 2578-95
    [PMID:22706288]
  34. Meinke DW
    A survey of dominant mutations in Arabidopsis thaliana.
    Trends Plant Sci., 2013. 18(2): p. 84-91
    [PMID:22995285]
  35. Zheng D, et al.
    The nitrate transporter NRT2.1 functions in the ethylene response to nitrate deficiency in Arabidopsis.
    Plant Cell Environ., 2013. 36(7): p. 1328-37
    [PMID:23305042]
  36. Kim HG, et al.
    GDSL LIPASE1 modulates plant immunity through feedback regulation of ethylene signaling.
    Plant Physiol., 2013. 163(4): p. 1776-91
    [PMID:24170202]
  37. Song S, et al.
    Interaction between MYC2 and ETHYLENE INSENSITIVE3 modulates antagonism between jasmonate and ethylene signaling in Arabidopsis.
    Plant Cell, 2014. 26(1): p. 263-79
    [PMID:24399301]
  38. Zhang GB,Yi HY,Gong JM
    The Arabidopsis ethylene/jasmonic acid-NRT signaling module coordinates nitrate reallocation and the trade-off between growth and environmental adaptation.
    Plant Cell, 2014. 26(10): p. 3984-98
    [PMID:25326291]
  39. Peng J, et al.
    Salt-induced stabilization of EIN3/EIL1 confers salinity tolerance by deterring ROS accumulation in Arabidopsis.
    PLoS Genet., 2014. 10(10): p. e1004664
    [PMID:25330213]
  40. Wang J, et al.
    Arabidopsis ROOT HAIR DEFECTIVE3 is involved in nitrogen starvation-induced anthocyanin accumulation.
    J Integr Plant Biol, 2015. 57(8): p. 708-21
    [PMID:25494721]
  41. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]
  42. Song J, et al.
    Biochemical and Structural Insights into the Mechanism of DNA Recognition by Arabidopsis ETHYLENE INSENSITIVE3.
    PLoS ONE, 2015. 10(9): p. e0137439
    [PMID:26352699]
  43. Qing D, et al.
    Quantitative and Functional Phosphoproteomic Analysis Reveals that Ethylene Regulates Water Transport via the C-Terminal Phosphorylation of Aquaporin PIP2;1 in Arabidopsis.
    Mol Plant, 2016. 9(1): p. 158-174
    [PMID:26476206]
  44. Poulios S,Vlachonasios KE
    Synergistic action of histone acetyltransferase GCN5 and receptor CLAVATA1 negatively affects ethylene responses in Arabidopsis thaliana.
    J. Exp. Bot., 2016. 67(3): p. 905-18
    [PMID:26596766]
  45. Shen X,Li Y,Pan Y,Zhong S
    Activation of HLS1 by Mechanical Stress via Ethylene-Stabilized EIN3 Is Crucial for Seedling Soil Emergence.
    Front Plant Sci, 2016. 7: p. 1571
    [PMID:27822221]
  46. Abozeid A, et al.
    Ethylene Improves Root System Development under Cadmium Stress by Modulating Superoxide Anion Concentration in Arabidopsis thaliana.
    Front Plant Sci, 2017. 8: p. 253
    [PMID:28286514]
  47. Feng Y, et al.
    Ethylene promotes root hair growth through coordinated EIN3/EIL1 and RHD6/RSL1 activity in Arabidopsis.
    Proc. Natl. Acad. Sci. U.S.A., 2017. 114(52): p. 13834-13839
    [PMID:29233944]
  48. Harkey AF, et al.
    Identification of Transcriptional and Receptor Networks That Control Root Responses to Ethylene.
    Plant Physiol., 2018. 176(3): p. 2095-2118
    [PMID:29259106]
  49. Chao Q, et al.
    Activation of the ethylene gas response pathway in Arabidopsis by the nuclear protein ETHYLENE-INSENSITIVE3 and related proteins.
    Cell, 1997. 89(7): p. 1133-44
    [PMID:9215635]
  50. Solano R,Stepanova A,Chao Q,Ecker JR
    Nuclear events in ethylene signaling: a transcriptional cascade mediated by ETHYLENE-INSENSITIVE3 and ETHYLENE-RESPONSE-FACTOR1.
    Genes Dev., 1998. 12(23): p. 3703-14
    [PMID:9851977]