PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G25230.1
Common NameAtMYB100, MYB100
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 234aa    MW: 27280.8 Da    PI: 8.0321
Description myb domain protein 100
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G25230.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.91.2e-132671147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     + +WT+ Ed +l++  ++ +++ W+++a+++  gRt+kqc++rw+++
      AT2G25230.1 26 KVNWTESEDIKLKEIMALGPKNKWTKVAKKFE-GRTGKQCRERWYNH 71
                     579*****************************.************97 PP

2Myb_DNA-binding582.2e-1879122247
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       +W++eEd++l++a+k lG++ W  Ia+ ++ gR+++++k++w++ 
      AT2G25230.1  79 TAWSEEEDQILIEAHKVLGTK-WVEIAQQLP-GRSDNNIKNHWNTT 122
                      68*******************.*********.************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.45E-101968IPR009057Homeodomain-like
PROSITE profilePS5129416.8252172IPR017930Myb domain
SMARTSM007172.3E-122574IPR001005SANT/Myb domain
PfamPF002491.7E-122671IPR001005SANT/Myb domain
CDDcd001676.82E-112871No hitNo description
Gene3DG3DSA:1.10.10.603.9E-202877IPR009057Homeodomain-like
SuperFamilySSF466893.64E-2852133IPR009057Homeodomain-like
PROSITE profilePS5129427.59373127IPR017930Myb domain
SMARTSM007179.3E-1777125IPR001005SANT/Myb domain
PfamPF002491.5E-1678122IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.6E-2178125IPR009057Homeodomain-like
CDDcd001671.23E-1180123No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0030154Biological Processcell differentiation
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 234 aa     Download sequence    Send to blast
MKKNYQKKNI KVVSTSKYLK KSDIDKVNWT ESEDIKLKEI MALGPKNKWT KVAKKFEGRT  60
GKQCRERWYN HARPNIKKTA WSEEEDQILI EAHKVLGTKW VEIAQQLPGR SDNNIKNHWN  120
TTKRRVQNKR GGTVNPVGNN ILENYIRCIT INNEDFLKTD GSYGEPTNIE SDDDSKDMLY  180
GEMNLSLETI TTQTTKPLTN ASTTSPYVQM PEDNYTMEDC ESLEDILELL RWWE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-36231254106B-MYB
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO58233400.0
Genevisible263615_at0.0
Expression AtlasAT2G25230-
AtGenExpressAT2G25230-
ATTED-IIAT2G25230-
Functional Description ? help Back to Top
Source Description
TAIREncodes a putative transcription factor (MYB100).
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G25230.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G25230
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF1760040.0AF176004.1 Arabidopsis thaliana putative transcription factor (MYB100) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_180095.11e-173myb domain protein 100
TrEMBLQ9S7541e-171Q9S754_ARATH; Myb domain protein 100
STRINGAT2G25230.11e-172(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM133031427
Representative plantOGRP5171784
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  3. Jiang C,Gu X,Peterson T
    Identification of conserved gene structures and carboxy-terminal motifs in the Myb gene family of Arabidopsis and Oryza sativa L. ssp. indica.
    Genome Biol., 2004. 5(7): p. R46
    [PMID:15239831]