PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G25180.1
Common NameARR12, F13D4.140, RR12
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family ARR-B
Protein Properties Length: 596aa    MW: 65626.5 Da    PI: 6.6282
Description response regulator 12
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G25180.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like86.42.9e-27195248155
      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                  k+r++Wt eLH++Fv av+qL G ekA Pk+il+lm+v+ Lt+e+v+SHLQk+Rl
  AT2G25180.1 195 KQRVVWTVELHKKFVAAVNQL-GYEKAMPKKILDLMNVEKLTRENVASHLQKFRL 248
                  79*******************.9*******************************8 PP

2Response_reg84.62.9e-28191271109
                   EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTES CS
  Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGak 95 
                   vl vdD+++ +++l+++l++ +y +v+++ ++++alell+e++  +Dl++ D++mp+mdG++ll+     e++lp+i+++ah++++++ + +  Ga 
   AT2G25180.1  19 VLAVDDDQTCLKILESLLRHCQY-HVTTTNQAQKALELLRENKnkFDLVISDVDMPDMDGFKLLELVGL-EMDLPVIMLSAHSDPKYVMKGVTHGAC 113
                   799********************.***************888888*******************87754.558************************ PP

                   EEEESS--HHHHHH CS
  Response_reg  96 dflsKpfdpeelvk 109
                   d+l Kp+ +eel +
   AT2G25180.1 114 DYLLKPVRIEELKN 127
                   ***********987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363926.6E-1931596IPR017053Response regulator B-type, plant
Gene3DG3DSA:3.40.50.23006.8E-4316169No hitNo description
SuperFamilySSF521721.99E-3516136IPR011006CheY-like superfamily
SMARTSM004482.0E-3317129IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011043.83518133IPR001789Signal transduction response regulator, receiver domain
PfamPF000721.3E-2519127IPR001789Signal transduction response regulator, receiver domain
CDDcd001563.20E-2820132No hitNo description
Gene3DG3DSA:1.10.10.605.9E-29192253IPR009057Homeodomain-like
PROSITE profilePS5129411.449192251IPR017930Myb domain
SuperFamilySSF466891.97E-19193252IPR009057Homeodomain-like
TIGRFAMsTIGR015572.0E-24195248IPR006447Myb domain, plants
PfamPF002491.6E-6197246IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0009414Biological Processresponse to water deprivation
GO:0010082Biological Processregulation of root meristem growth
GO:0010380Biological Processregulation of chlorophyll biosynthetic process
GO:0031537Biological Processregulation of anthocyanin metabolic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048367Biological Processshoot system development
GO:0080022Biological Processprimary root development
GO:0080036Biological Processregulation of cytokinin-activated signaling pathway
GO:0080113Biological Processregulation of seed growth
GO:0005634Cellular Componentnucleus
GO:0000156Molecular Functionphosphorelay response regulator activity
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000025anatomyroot tip
PO:0000036anatomyleaf vascular system
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000282anatomytrichome
PO:0000293anatomyguard cell
PO:0003000anatomytransition zone
PO:0005660anatomyhydathode
PO:0006079anatomyshoot system meristem
PO:0006339anatomyjuvenile vascular leaf
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 596 aa     Download sequence    Send to blast
MTVEQNLEAL DQFPVGMRVL AVDDDQTCLK ILESLLRHCQ YHVTTTNQAQ KALELLRENK  60
NKFDLVISDV DMPDMDGFKL LELVGLEMDL PVIMLSAHSD PKYVMKGVTH GACDYLLKPV  120
RIEELKNIWQ HVVRSRFDKN RGSNNNGDKR DGSGNEGVGN SDQNNGKGNR KRKDQYNEDE  180
DEDRDDNDDS CAQKKQRVVW TVELHKKFVA AVNQLGYEKA MPKKILDLMN VEKLTRENVA  240
SHLQKFRLYL KRISGVANQQ AIMANSELHF MQMNGLDGFH HRPIPVGSGQ YHGGAPAMRS  300
FPPNGILGRL NTPSGIGVRS LSSPPAGMFL QNQTDIGKFH HVSSLPLNHS DGGNILQGLP  360
MPLEFDQLQT NNNKSRNMNS NKSIAGTSMA FPSFSTQQNS LISAPNNNVV VLEGHPQATP  420
PGFPGHQINK RLEHWSNAVS SSTHPPPPAH NSNSINHQFD VSPLPHSRPD PLEWNNVSSS  480
YSIPFCDSAN TLSSPALDTT NPRAFCRNTD FDSNTNVQPG VFYGPSTDAM ALLSSSNPKE  540
GFVVGQQKLQ SGGFMVADAG SLDDIVNSTM KQEQSQGDLS GGDLGYGGFS SLRTCI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A7e-26192254264ARR10-B
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.197750.0flower| root| seed
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO2402545270.0
Genevisible264374_at0.0
Expression AtlasAT2G25180-
AtGenExpressAT2G25180-
ATTED-IIAT2G25180-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Detected immediately after seed germination. {ECO:0000269|PubMed:17363254}.
UniprotTISSUE SPECIFICITY: Detected in the whole plant. Predominantly expressed in leaves. Expressed at the root transition zone (PubMed:17363254). {ECO:0000269|PubMed:15173562, ECO:0000269|PubMed:17363254}.
Functional Description ? help Back to Top
Source Description
TAIREncodes an Arabidopsis response regulator (ARR) protein that acts in concert with other type-B ARRs in the cytokinin signaling pathway.
UniProtTranscriptional activator that binds specifically to the DNA sequence 5'-[AG]GATT-3'. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. Could directly activate some type-A response regulators in response to cytokinins. Involved in the root-meristem size determination through the regulation of cell differentiation (PubMed:17363254). Involved in activating SHY2 during meristem growth and controls PIN expression via activation of SHY2 (PubMed:20605455). {ECO:0000250|UniProtKB:Q940D0, ECO:0000269|PubMed:17363254, ECO:0000269|PubMed:20605455}.
Function -- GeneRIF ? help Back to Top
  1. ARR10 and ARR12play pivotal roles in the histidine kinase-dependent phosphorelay signaling in response to cytokinin in roots.
    [PMID: 17132632]
  2. The results of this study suggested that ARR1, ARR10 and ARR12 together play essential (or general) roles in cytokinin signal transduction.
    [PMID: 18037673]
  3. Results support a model in which cytokinin regulates a wide array of downstream responses through the action of a multistep phosphorelay that culminates in transcriptional regulation by ARR1, ARR10, and ARR12.
    [PMID: 18723577]
  4. Cytokinin regulates sodium homeostasis via ARR1 and ARR12, and acts through ARR1 and ARR12 to regulate AtHKT1;1 expression.
    [PMID: 21105923]
  5. low temperature inhibits root growth by reducing auxin accumulation via ARR1/12.
    [PMID: 25552473]
  6. The cytokinin module ARABIDOPSIS HISTIDINE KINASE3 (AHK3)/ARABIDOPSIS RESPONSE REGULATOR1 (ARR1)/ARR12 was found to interact with the GR24-dependent reduction in LR development, because mutants in this pathway rendered LR development insensitive to GR24.
    [PMID: 26519957]
  7. An arr1,10,12 triple mutant had more drought tolerance due to enhanced cell membrane integrity, anthocyanin synthesis, and abscissic acid hypersensitivity, and reduced stomatal aperture. Dehydration and ABA repressed all 3 genes.
    [PMID: 26884175]
  8. ARR12 binds to the promoter of WUS.
    [PMID: 28681564]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G25180.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDcytokinin
Interaction ? help Back to Top
Source Intact With
BioGRIDAT4G11140, AT4G23750
IntActSearch P62598
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G25180
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0026850.0CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_180090.60.0response regulator 12
SwissprotP625980.0ARR12_ARATH; Two-component response regulator ARR12
TrEMBLA0A178VV070.0A0A178VV07_ARATH; Two-component response regulator
STRINGAT2G25180.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19812879
Representative plantOGRP29217120
Publications ? help Back to Top
  1. White JA, et al.
    A new set of Arabidopsis expressed sequence tags from developing seeds. The metabolic pathway from carbohydrates to seed oil.
    Plant Physiol., 2000. 124(4): p. 1582-94
    [PMID:11115876]
  2. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  3. Hwang I,Sheen J
    Two-component circuitry in Arabidopsis cytokinin signal transduction.
    Nature, 2001. 413(6854): p. 383-9
    [PMID:11574878]
  4. Hwang I,Chen HC,Sheen J
    Two-component signal transduction pathways in Arabidopsis.
    Plant Physiol., 2002. 129(2): p. 500-15
    [PMID:12068096]
  5. Mason MG,Li J,Mathews DE,Kieber JJ,Schaller GE
    Type-B response regulators display overlapping expression patterns in Arabidopsis.
    Plant Physiol., 2004. 135(2): p. 927-37
    [PMID:15173562]
  6. Mason MG, et al.
    Multiple type-B response regulators mediate cytokinin signal transduction in Arabidopsis.
    Plant Cell, 2005. 17(11): p. 3007-18
    [PMID:16227453]
  7. Yokoyama A, et al.
    Type-B ARR transcription factors, ARR10 and ARR12, are implicated in cytokinin-mediated regulation of protoxylem differentiation in roots of Arabidopsis thaliana.
    Plant Cell Physiol., 2007. 48(1): p. 84-96
    [PMID:17132632]
  8. Dello Ioio R, et al.
    Cytokinins determine Arabidopsis root-meristem size by controlling cell differentiation.
    Curr. Biol., 2007. 17(8): p. 678-82
    [PMID:17363254]
  9. Ishida K,Yamashino T,Yokoyama A,Mizuno T
    Three type-B response regulators, ARR1, ARR10 and ARR12, play essential but redundant roles in cytokinin signal transduction throughout the life cycle of Arabidopsis thaliana.
    Plant Cell Physiol., 2008. 49(1): p. 47-57
    [PMID:18037673]
  10. Argyros RD, et al.
    Type B response regulators of Arabidopsis play key roles in cytokinin signaling and plant development.
    Plant Cell, 2008. 20(8): p. 2102-16
    [PMID:18723577]
  11. Moubayidin L, et al.
    The rate of cell differentiation controls the Arabidopsis root meristem growth phase.
    Curr. Biol., 2010. 20(12): p. 1138-43
    [PMID:20605455]
  12. Kondo Y,Hirakawa Y,Kieber JJ,Fukuda H
    CLE peptides can negatively regulate protoxylem vessel formation via cytokinin signaling.
    Plant Cell Physiol., 2011. 52(1): p. 37-48
    [PMID:20802224]
  13. Shin R,Jez JM,Basra A,Zhang B,Schachtman DP
    14-3-3 proteins fine-tune plant nutrient metabolism.
    FEBS Lett., 2011. 585(1): p. 143-7
    [PMID:21094157]
  14. Mason MG, et al.
    Type-B response regulators ARR1 and ARR12 regulate expression of AtHKT1;1 and accumulation of sodium in Arabidopsis shoots.
    Plant J., 2010. 64(5): p. 753-63
    [PMID:21105923]
  15. Cutcliffe JW,Hellmann E,Heyl A,Rashotte AM
    CRFs form protein-protein interactions with each other and with members of the cytokinin signalling pathway in Arabidopsis via the CRF domain.
    J. Exp. Bot., 2011. 62(14): p. 4995-5002
    [PMID:21705390]
  16. Elhiti M,Stasolla C
    In vitro shoot organogenesis and hormone response are affected by the altered levels of Brassica napus meristem genes.
    Plant Sci., 2012. 190: p. 40-51
    [PMID:22608518]
  17. Das PK, et al.
    Cytokinins enhance sugar-induced anthocyanin biosynthesis in Arabidopsis.
    Mol. Cells, 2012. 34(1): p. 93-101
    [PMID:22699753]
  18. Hill K, et al.
    Functional characterization of type-B response regulators in the Arabidopsis cytokinin response.
    Plant Physiol., 2013. 162(1): p. 212-24
    [PMID:23482873]
  19. Kim HJ,Chiang YH,Kieber JJ,Schaller GE
    SCF(KMD) controls cytokinin signaling by regulating the degradation of type-B response regulators.
    Proc. Natl. Acad. Sci. U.S.A., 2013. 110(24): p. 10028-33
    [PMID:23720308]
  20. Takahashi N, et al.
    Cytokinins control endocycle onset by promoting the expression of an APC/C activator in Arabidopsis roots.
    Curr. Biol., 2013. 23(18): p. 1812-7
    [PMID:24035544]
  21. Cortleven A, et al.
    A novel protective function for cytokinin in the light stress response is mediated by the Arabidopsis histidine kinase2 and Arabidopsis histidine kinase3 receptors.
    Plant Physiol., 2014. 164(3): p. 1470-83
    [PMID:24424319]
  22. Kim HJ,Kieber JJ,Schaller GE
    The rice F-box protein KISS ME DEADLY2 functions as a negative regulator of cytokinin signalling.
    Plant Signal Behav, 2013. 8(12): p. e26434
    [PMID:24675172]
  23. Choi SH, et al.
    Gene duplication of type-B ARR transcription factors systematically extends transcriptional regulatory structures in Arabidopsis.
    Sci Rep, 2014. 4: p. 7197
    [PMID:25425016]
  24. Zhu J, et al.
    Low temperature inhibits root growth by reducing auxin accumulation via ARR1/12.
    Plant Cell Physiol., 2015. 56(4): p. 727-36
    [PMID:25552473]
  25. Jiang L, et al.
    Strigolactones spatially influence lateral root development through the cytokinin signaling network.
    J. Exp. Bot., 2016. 67(1): p. 379-89
    [PMID:26519957]
  26. Nguyen KH, et al.
    Arabidopsis type B cytokinin response regulators ARR1, ARR10, and ARR12 negatively regulate plant responses to drought.
    Proc. Natl. Acad. Sci. U.S.A., 2016. 113(11): p. 3090-5
    [PMID:26884175]
  27. Cortleven A, et al.
    Cytokinin Regulates the Etioplast-Chloroplast Transition through the Two-Component Signaling System and Activation of Chloroplast-Related Genes.
    Plant Physiol., 2016. 172(1): p. 464-78
    [PMID:27388681]
  28. Kobayashi K, et al.
    Shoot Removal Induces Chloroplast Development in Roots via Cytokinin Signaling.
    Plant Physiol., 2017. 173(4): p. 2340-2355
    [PMID:28193764]
  29. Zhang TQ, et al.
    A Two-Step Model for de Novo Activation of WUSCHEL during Plant Shoot Regeneration.
    Plant Cell, 2017. 29(5): p. 1073-1087
    [PMID:28389585]
  30. Meng WJ, et al.
    Type-B ARABIDOPSIS RESPONSE REGULATORs Specify the Shoot Stem Cell Niche by Dual Regulation of WUSCHEL.
    Plant Cell, 2017. 29(6): p. 1357-1372
    [PMID:28576846]
  31. Kobayashi K,Iwase A
    Simultaneous but spatially different regulation of non-photosynthetic callus formation and photosynthetic root development after shoot removal.
    Plant Signal Behav, 2017. 12(6): p. e1338999
    [PMID:28594268]
  32. Dai X, et al.
    ARR12 promotes de novo shoot regeneration in Arabidopsis thaliana via activation of WUSCHEL expression.
    J Integr Plant Biol, 2017. 59(10): p. 747-758
    [PMID:28681564]
  33. Zhang F,May A,Irish VF
    Type-B ARABIDOPSIS RESPONSE REGULATORs Directly Activate WUSCHEL.
    Trends Plant Sci., 2017. 22(10): p. 815-817
    [PMID:28886911]
  34. Yan Z, et al.
    Type B Response Regulators Act As Central Integrators in Transcriptional Control of the Auxin Biosynthesis Enzyme TAA1.
    Plant Physiol., 2017. 175(3): p. 1438-1454
    [PMID:28931628]
  35. Bustillo-AvendaƱo E, et al.
    Regulation of Hormonal Control, Cell Reprogramming, and Patterning during De Novo Root Organogenesis.
    Plant Physiol., 2018. 176(2): p. 1709-1727
    [PMID:29233938]