PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G24840.1
Common NameAGL61, DIA, F27C12.24
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family M-type_MADS
Protein Properties Length: 264aa    MW: 30264.3 Da    PI: 10.1557
Description AGAMOUS-like 61
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G24840.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF67.41.4e-2172114345
                  --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
       SRF-TF   3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45 
                  i+ +s rqvtfskRr+g++KKA+EL++LC+ae+ +i+fs+  k
  AT2G24840.1  72 IKKESHRQVTFSKRRAGLFKKASELCTLCGAEIGIIVFSPAKK 114
                  8999***********************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.4E-3062121IPR002100Transcription factor, MADS-box
PROSITE profilePS5006623.59162122IPR002100Transcription factor, MADS-box
CDDcd002654.86E-3463130No hitNo description
SuperFamilySSF554557.98E-2863140IPR002100Transcription factor, MADS-box
PRINTSPR004047.2E-176484IPR002100Transcription factor, MADS-box
PfamPF003194.1E-2571118IPR002100Transcription factor, MADS-box
PRINTSPR004047.2E-178499IPR002100Transcription factor, MADS-box
PRINTSPR004047.2E-1799120IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009559Biological Processembryo sac central cell differentiation
GO:0043078Cellular Componentpolar nucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
GO:0046983Molecular Functionprotein dimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009089anatomyendosperm
PO:0020090anatomyembryo sac central cell
Sequence ? help Back to Top
Protein Sequence    Length: 264 aa     Download sequence    Send to blast
MYVTKYKNKL PTLQVDLIIM PHQTQACIYK QTLSLHQIFQ QRKATKTLHT KKTMMSKKKE  60
SIGRQKIPMV KIKKESHRQV TFSKRRAGLF KKASELCTLC GAEIGIIVFS PAKKPFSFGH  120
PSVESVLDRY VSRNNMSLAQ SQQLQGSPAA SCELNMQLTH ILSEVEEEKK KGQAMEEMRK  180
ESVRRSMINW WEKPVEEMNM VQLQEMKYAL EELRKTVVTN MASFNEAKDD VFGFLDNKVT  240
VPPYVNMPSG PSNIYNFANG NGCF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3kov_A5e-1563134172Myocyte-specific enhancer factor 2A
3kov_B5e-1563134172Myocyte-specific enhancer factor 2A
3kov_I5e-1563134172Myocyte-specific enhancer factor 2A
3kov_J5e-1563134172Myocyte-specific enhancer factor 2A
3p57_A5e-1563134172Myocyte-specific enhancer factor 2A
3p57_B5e-1563134172Myocyte-specific enhancer factor 2A
3p57_C5e-1563134172Myocyte-specific enhancer factor 2A
3p57_D5e-1563134172Myocyte-specific enhancer factor 2A
3p57_I5e-1563134172Myocyte-specific enhancer factor 2A
3p57_J5e-1563134172Myocyte-specific enhancer factor 2A
5f28_A5e-1562134173MEF2C
5f28_B5e-1562134173MEF2C
5f28_C5e-1562134173MEF2C
5f28_D5e-1562134173MEF2C
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO2402545260.0
Genevisible263525_at0.0
Expression AtlasAT2G24840-
AtGenExpressAT2G24840-
ATTED-IIAT2G24840-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed in the final stages of embryo sac development. {ECO:0000269|PubMed:18713950}.
UniprotTISSUE SPECIFICITY: Expressed exclusively in the central cell of the female gametophyte and in early endosperm. {ECO:0000269|PubMed:18599653, ECO:0000269|PubMed:18713950}.
Functional Description ? help Back to Top
Source Description
TAIREncodes a member of the Agamous-like family of transcription factors. Localized to the nucleus in the central cell and endosperm of the female gametophyte. Loss of function mutations show reduced female fertility. Fifty percent of ovules have defective central cells with abnormal morphology and patterns of gene expression. Upon fertilization 50% of seeds abort. Using yeast two hybrid assays AGL61 was shown to interact with AGL80, another MADS box gene with similar defects in ovule development. These data suggest that AGL61 and 80 together are required for proper differentiation of the central cell.
UniProtProbable transcription factor. Controls central cell differentiation during female gametophyte development. {ECO:0000269|PubMed:18599653, ECO:0000269|PubMed:18713950}.
Function -- GeneRIF ? help Back to Top
  1. controls the expression of downstream genes during central cell development
    [PMID: 18599653]
  2. DIANA (AGL61) forms a complex with AGL80 to specify the central cell in Arabidopsis ovules. [AGL61] [DIANA]
    [PMID: 18713950]
  3. Data show that AGL61 and AGL80 appear to function together to differentiate the central cell in Arabidopsis. Data renamed AGL61 DIANA, after the virginal Roman goddess of the hunt.
    [PMID: 18713950]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G24840.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
BioGRIDAT5G48670
IntActSearch Q4PSU4
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G24840
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0065850.0AC006585.8 Arabidopsis thaliana chromosome 2 clone F27C12 map mi238, complete sequence.
GenBankCP0026850.0CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence.
GenBankDQ0565420.0DQ056542.1 Arabidopsis thaliana MADS-box family protein (At2g24840) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_850058.10.0AGAMOUS-like 61
SwissprotQ4PSU40.0AGL61_ARATH; Agamous-like MADS-box protein AGL61
TrEMBLC0SV611e-155C0SV61_ARATH; Uncharacterized protein At2g24840 (Fragment)
STRINGAT2G24840.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM8628390
Representative plantOGRP1617761
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. De Bodt S, et al.
    Genomewide structural annotation and evolutionary analysis of the type I MADS-box genes in plants.
    J. Mol. Evol., 2003. 56(5): p. 573-86
    [PMID:12698294]
  3. Parenicov√° L, et al.
    Molecular and phylogenetic analyses of the complete MADS-box transcription factor family in Arabidopsis: new openings to the MADS world.
    Plant Cell, 2003. 15(7): p. 1538-51
    [PMID:12837945]
  4. Kofuji R, et al.
    Evolution and divergence of the MADS-box gene family based on genome-wide expression analyses.
    Mol. Biol. Evol., 2003. 20(12): p. 1963-77
    [PMID:12949148]
  5. de Folter S, et al.
    Comprehensive interaction map of the Arabidopsis MADS Box transcription factors.
    Plant Cell, 2005. 17(5): p. 1424-33
    [PMID:15805477]
  6. Popescu SC, et al.
    Differential binding of calmodulin-related proteins to their targets revealed through high-density Arabidopsis protein microarrays.
    Proc. Natl. Acad. Sci. U.S.A., 2007. 104(11): p. 4730-5
    [PMID:17360592]
  7. Johnston AJ, et al.
    Genetic subtraction profiling identifies genes essential for Arabidopsis reproduction and reveals interaction between the female gametophyte and the maternal sporophyte.
    Genome Biol., 2007. 8(10): p. R204
    [PMID:17915010]
  8. Steffen JG,Kang IH,Portereiko MF,Lloyd A,Drews GN
    AGL61 interacts with AGL80 and is required for central cell development in Arabidopsis.
    Plant Physiol., 2008. 148(1): p. 259-68
    [PMID:18599653]
  9. Bemer M,Wolters-Arts M,Grossniklaus U,Angenent GC
    The MADS domain protein DIANA acts together with AGAMOUS-LIKE80 to specify the central cell in Arabidopsis ovules.
    Plant Cell, 2008. 20(8): p. 2088-101
    [PMID:18713950]
  10. Bemer M,Heijmans K,Airoldi C,Davies B,Angenent GC
    An atlas of type I MADS box gene expression during female gametophyte and seed development in Arabidopsis.
    Plant Physiol., 2010. 154(1): p. 287-300
    [PMID:20631316]
  11. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]