PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G24790.1
Common NameATCOL3, BBX4, COL3, F27C12.29
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family CO-like
Protein Properties Length: 294aa    MW: 32324.2 Da    PI: 6.6533
Description CONSTANS-like 3
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G24790.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box29.71.3e-09547339
     zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htv 39
                  r C+ +++  ++lfC+ +  +lC dC  ++H        H++
  AT2G24790.1  5 SRLCDSCKSTAATLFCRADAAFLCGDCDGKIHTAnklasrHER 47
                 689******99*********************55666767765 PP

2zf-B_box27.85.1e-094893342
     zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42
                  + C+ +e+ +++  C+ +   lC +C   +H+       H++vp+
  AT2G24790.1 48 VWLCEVCEQAPAHVTCKADAAALCVTCDRDIHSAnplsrrHERVPI 93
                 689*****************************66899999*99997 PP

3CCT69.67.8e-24229272144
          CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                  Rea++lRY+eKrk+RkFeK+irY+sRKa+Ae RpR+KGrF+k++
  AT2G24790.1 229 REARVLRYREKRKNRKFEKTIRYASRKAYAEMRPRIKGRFAKRT 272
                  9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003367.8E-15350IPR000315B-box-type zinc finger
PROSITE profilePS5011910.765350IPR000315B-box-type zinc finger
PfamPF006431.6E-7547IPR000315B-box-type zinc finger
CDDcd000214.31E-9650No hitNo description
PROSITE profilePS5011911.0494693IPR000315B-box-type zinc finger
PfamPF006432.7E-74893IPR000315B-box-type zinc finger
CDDcd000213.79E-104993No hitNo description
SMARTSM003362.4E-115193IPR000315B-box-type zinc finger
PROSITE profilePS5101716.658229271IPR010402CCT domain
PfamPF062031.2E-17229271IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009909Biological Processregulation of flower development
GO:0010099Biological Processregulation of photomorphogenesis
GO:0010161Biological Processred light signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
MASSSRLCDS CKSTAATLFC RADAAFLCGD CDGKIHTANK LASRHERVWL CEVCEQAPAH  60
VTCKADAAAL CVTCDRDIHS ANPLSRRHER VPITPFYDAV GPAKSASSSV NFVDEDGGDV  120
TASWLLAKEG IEITNLFSDL DYPKIEVTSE ENSSGNDGVV PVQNKLFLNE DYFNFDLSAS  180
KISQQGFNFI NQTVSTRTID VPLVPESGGV TAEMTNTETP AVQLSPAERE ARVLRYREKR  240
KNRKFEKTIR YASRKAYAEM RPRIKGRFAK RTDSRENDGG DVGVYGGFGV VPSF
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.243620.0bud| cell culture| flower| leaf| root| vegetative tissue
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO306825540.0
Genevisible263537_at0.0
Expression AtlasAT2G24790-
AtGenExpressAT2G24790-
ATTED-IIAT2G24790-
Functional Description ? help Back to Top
Source Description
TAIRPositive regulator of photomorphogenesis that acts downstream of COP1 but can promote lateral root development independently of COP1 and also function as a daylength-sensitive regulator of shoot branching.
Function -- GeneRIF ? help Back to Top
  1. CONSTANS-LIKE3 (COL3)is a positive regulator of photomorphogenesis that acts downstream of COP1 and can function as a daylength-sensitive regulator of shoot branching. [COL3]
    [PMID: 16339850]
  2. COL3 targets FT in the presence of BBX32 to regulate the flowering pathway. This study identifies COL3 as a critical protein-binding partner for BBX32 action in Arabidopsis.
    [PMID: 27999181]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G24790.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
IntActSearch Q9SK53
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G24790
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0581300.0AY058130.1 Arabidopsis thaliana At2g24790/F27A10.10 mRNA, complete cds.
GenBankAY1401030.0AY140103.1 Arabidopsis thaliana CONSTANS-like B-box zinc finger protein (At2g24790) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_180052.10.0CONSTANS-like 3
SwissprotQ9SK530.0COL3_ARATH; Zinc finger protein CONSTANS-LIKE 3
TrEMBLA0A178VTY80.0A0A178VTY8_ARATH; COL3
STRINGAT2G24790.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM27602765
Representative plantOGRP6911767
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Robson F, et al.
    Functional importance of conserved domains in the flowering-time gene CONSTANS demonstrated by analysis of mutant alleles and transgenic plants.
    Plant J., 2001. 28(6): p. 619-31
    [PMID:11851908]
  3. Izawa T,Takahashi Y,Yano M
    Comparative biology comes into bloom: genomic and genetic comparison of flowering pathways in rice and Arabidopsis.
    Curr. Opin. Plant Biol., 2003. 6(2): p. 113-20
    [PMID:12667866]
  4. Griffiths S,Dunford RP,Coupland G,Laurie DA
    The evolution of CONSTANS-like gene families in barley, rice, and Arabidopsis.
    Plant Physiol., 2003. 131(4): p. 1855-67
    [PMID:12692345]
  5. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  6. Lu Y,Zhu J,Liu P
    A two-step strategy for detecting differential gene expression in cDNA microarray data.
    Curr. Genet., 2005. 47(2): p. 121-31
    [PMID:15688252]
  7. Zobell O,Coupland G,Reiss B
    The family of CONSTANS-like genes in Physcomitrella patens.
    Plant Biol (Stuttg), 2005. 7(3): p. 266-75
    [PMID:15912446]
  8. Fukamatsu Y, et al.
    Identification of LOV KELCH PROTEIN2 (LKP2)-interacting factors that can recruit LKP2 to nuclear bodies.
    Plant Cell Physiol., 2005. 46(8): p. 1340-9
    [PMID:15937324]
  9. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  10. Datta S,Hettiarachchi GH,Deng XW,Holm M
    Arabidopsis CONSTANS-LIKE3 is a positive regulator of red light signaling and root growth.
    Plant Cell, 2006. 18(1): p. 70-84
    [PMID:16339850]
  11. Cao D,Cheng H,Wu W,Soo HM,Peng J
    Gibberellin mobilizes distinct DELLA-dependent transcriptomes to regulate seed germination and floral development in Arabidopsis.
    Plant Physiol., 2006. 142(2): p. 509-25
    [PMID:16920880]
  12. Manzano C,Abraham Z,L
    Identification of ubiquitinated proteins in Arabidopsis.
    Plant Mol. Biol., 2008. 68(1-2): p. 145-58
    [PMID:18535787]
  13. Ascencio-Ib
    Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection.
    Plant Physiol., 2008. 148(1): p. 436-54
    [PMID:18650403]
  14. Khanna R, et al.
    The Arabidopsis B-box zinc finger family.
    Plant Cell, 2009. 21(11): p. 3416-20
    [PMID:19920209]
  15. Tripathi P,Carvallo M,Hamilton EE,Preuss S,Kay SA
    Arabidopsis B-BOX32 interacts with CONSTANS-LIKE3 to regulate flowering.
    Proc. Natl. Acad. Sci. U.S.A., 2017. 114(1): p. 172-177
    [PMID:27999181]