PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G24700.1
Common NameF27A10.1, REM10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family B3
Protein Properties Length: 555aa    MW: 63258.5 Da    PI: 7.4554
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G24700.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B339.31.1e-1221971096
                 HHHTT-EE--HHH.HTT..---..--SEEEEEE.TTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEE CS
           B3 10 vlksgrlvlpkkfaeeh..ggkkeesktltled.esgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkv 96
                  ++++ l +p  f+ ++  g +   +kt  l++  s  +W+vk+  ++++    l++GW++F  a++L++gD+vvF+    +e+elv++v
  AT2G24700.1 21 GFTNH-LDIPVAFFLKYlvGTN--VGKTAELRSdASEMTWKVKI--DGRR----LSNGWEDFTIAHDLRVGDIVVFR----QEGELVFHV 97
                 56666.99*********87544..4567777775899*******..9998....***********************....455666665 PP

2B363.63e-20153244497
                  E-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE...EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
           B3   4 vltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliy.rkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97 
                  ++++ ++lk++ l++pk+fa ++g+   ++ +++l++e+g+sW++ l+    + gr+++++GW++F+ ang k gD++ Fkl++ +e+++++++f
  AT2G24700.1 153 ATVTGSNLKRDTLYIPKEFALSNGLM--NKYQIVLMNEEGESWKIDLRReAYNYGRFYMRRGWRSFCIANGKKPGDVFAFKLVK-NEETPMIQLF 244
                  56788999***************877..4568***************887677788**************************99.5566898887 PP

3B360.72.4e-19279367495
                  E-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS
           B3   4 vltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95 
                  +++++++l+++rl+lpk+f+ ++g+   +++++ l++e+g+sW++ ++++ + gr++  +GW++F+ ang k gD + Fkl+++ e+++v++
  AT2G24700.1 279 ATVTASNLSRDRLYLPKTFIMSNGLL--KKFQMCLMNEEGESWTIDVKHEAHTGRFLTIRGWRRFCVANGKKPGDLLKFKLVHN-EETPVLQ 367
                  567999*****************998..4568************************999**********************995.4446665 PP

4B3406.9e-13466554799
                  .-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
           B3   7 psdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 
                  +   + s+ l lp +f++++g+kk++  ++t+ d+   +W+  l ++k + ++ l++G k+F++ ng++ +++++++l++ +++ +++k+++k
  AT2G24700.1 466 TLTLTHSSKLNLPFEFMKRNGIKKAG--KITMVDRYDAKWRTSLLMDKIG-TMSLGRGSKGFCEVNGVEMNESFILELIW-EDTVPLLKFCSK 554
                  55566778899**********99887..7***************877776.568**************************.788899999987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.101.1E-188105IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019369.81E-199109IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086311.13811103IPR003340B3 DNA binding domain
CDDcd100171.52E-121298No hitNo description
SMARTSM010195.6E-2114103IPR003340B3 DNA binding domain
PfamPF023621.2E-72497IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.2E-21146240IPR015300DNA-binding pseudobarrel domain
CDDcd100173.20E-20150245No hitNo description
PROSITE profilePS5086316.102150247IPR003340B3 DNA binding domain
SuperFamilySSF1019362.55E-21150246IPR015300DNA-binding pseudobarrel domain
SMARTSM010192.3E-33151247IPR003340B3 DNA binding domain
PfamPF023625.8E-19152244IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.103.7E-20269366IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.29E-20270367IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086313.817276372IPR003340B3 DNA binding domain
CDDcd100171.69E-18276370No hitNo description
SMARTSM010193.6E-30277372IPR003340B3 DNA binding domain
PfamPF023625.6E-18279368IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.103.2E-15457554IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019367.06E-16459553IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS508639.009460554IPR003340B3 DNA binding domain
CDDcd100175.59E-10463553No hitNo description
SMARTSM010195.3E-21464555IPR003340B3 DNA binding domain
PfamPF023622.8E-11466554IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 555 aa     Download sequence    Send to blast
MANPLLYSPI NPQFFQPLLP GFTNHLDIPV AFFLKYLVGT NVGKTAELRS DASEMTWKVK  60
IDGRRLSNGW EDFTIAHDLR VGDIVVFRQE GELVFHVTAL GPSCCEIQYG EDTLEEDKIE  120
KLCGTENVSS KKKSLKREAE SAPDNSLDSC FVATVTGSNL KRDTLYIPKE FALSNGLMNK  180
YQIVLMNEEG ESWKIDLRRE AYNYGRFYMR RGWRSFCIAN GKKPGDVFAF KLVKNEETPM  240
IQLFPMTIED LDKLQSLPRH KIRKTEAAPS SPDLSSFVAT VTASNLSRDR LYLPKTFIMS  300
NGLLKKFQMC LMNEEGESWT IDVKHEAHTG RFLTIRGWRR FCVANGKKPG DLLKFKLVHN  360
EETPVLQLLP LNSEDLHKLN PSNDTRHGQS LKVTKKEFLG MEATENEFLG EEVYCNDSFK  420
ASEKDTLPFA EPINEDIRQG QCSQTIKQEY VSTEEKNSTS QNRFVTLTLT HSSKLNLPFE  480
FMKRNGIKKA GKITMVDRYD AKWRTSLLMD KIGTMSLGRG SKGFCEVNGV EMNESFILEL  540
IWEDTVPLLK FCSKV
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1453602910.0
Expression AtlasAT2G24700-
AtGenExpressAT2G24700-
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G24700.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G24700
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0072661e-159AC007266.5 Arabidopsis thaliana chromosome 2 clone F27A10 map mi238, complete sequence.
GenBankCP0026851e-159CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_180046.20.0Transcriptional factor B3 family protein
SwissprotP0DH850.0REM10_ARATH; B3 domain-containing protein REM10
TrEMBLA0A178W1E40.0A0A178W1E4_ARATH; Uncharacterized protein
STRINGAT2G24700.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM144901522
Representative plantOGRP2682231
Publications ? help Back to Top
  1. Castelli V, et al.
    Whole genome sequence comparisons and "full-length" cDNA sequences: a combined approach to evaluate and improve Arabidopsis genome annotation.
    Genome Res., 2004. 14(3): p. 406-13
    [PMID:14993207]
  2. Swaminathan K,Peterson K,Jack T
    The plant B3 superfamily.
    Trends Plant Sci., 2008. 13(12): p. 647-55
    [PMID:18986826]
  3. Mantegazza O, et al.
    Analysis of the arabidopsis REM gene family predicts functions during flower development.
    Ann. Bot., 2014. 114(7): p. 1507-15
    [PMID:25002525]