PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G24645.1
Common NameF25P17.5, REM14
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family B3
Protein Properties Length: 490aa    MW: 55530.2 Da    PI: 9.7888
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G24645.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B345.11.8e-14691196
                 EEEE-..-HHHHTT-EE--HHH.HTT.---..--SEEEEEE.TTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEE CS
           B3  1 ffkvltpsdvlksgrlvlpkkfaeeh.ggkkeesktltled.esgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkv 96
                 ffk l     + ++ l++p  f+ ++ +g   e+kt  l++  s  +Wevk+  ++++    lt+GWkeF+ +++L+ gD+vvF+ +++++f  +v++
  AT2G24645.1  6 FFKPL--LPGFHTH-LRIPVAFFLKNiEGR-YEQKTAELRSdASKITWEVKI--DGQR----LTDGWKEFALSHDLRIGDIVVFRQERDMSF--HVTM 91
                 56666..5566666.9******99997444.355688888868889******..9888....***********************8777888..7765 PP

2B369.73.8e-22132223397
                  EE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
           B3   3 kvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97 
                  ++ + +++l+ +++ +p  f++e+g +  +s +++l++e+grsW+++l+ + + g+++ ++GW +F++angL++gD+ +Fkl++ ++++lv++++
  AT2G24645.1 132 SANVAPSSLRYDLMLFPMGFVRENGVV--GSGKIVLMNEKGRSWNFNLRQKPSCGTVYVRGGWVSFCDANGLQAGDIYTFKLIK-RGGTLVLRLL 223
                  5677899999**************977..7779***************99999999***************************9.5666777765 PP

3B376.52.9e-24239331498
                  E-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
           B3   4 vltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                  + + +++l+ + l+lpk+f++e+g +k+++ +++l++e+g+sW++ l+ +k+ g+ ++++GW++F++angL++g +++Fkl++ ++++lv+ +++
  AT2G24645.1 239 ANVAPSTLRYDTLYLPKRFMRENGVDKRRG-EMILMNEKGKSWTLDLKLKKSCGTSLIRRGWRSFCSANGLRAGSIITFKLIK-KSGTLVLCLLS 331
                  5678899999*************9999887.***************************************************9.77778887766 PP

4B357.91.9e-18387484199
                  EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE...EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
           B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliy.rkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97 
                  f++  +++++  ++ l+lp +f++ +g+++e  +++tl d++g +W  +l+  + k++r  + +GWk+F +ang+k++++++++l++++e+++v+k++
  AT2G24645.1 387 FVTLNLTPYNILRSALRLPIPFTRMNGINEE--TKMTLLDKHGMKWLTTLRLvDYKRKRLGMVGGWKGFIQANGVKANESIMLELIWEEETSCVLKFC 482
                  667778899999999***********99954..58***************888999999999***********************************9 PP

                  -S CS
           B3  98 rk 99 
                  +k
  AT2G24645.1 483 SK 484
                  87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019363.14E-193102IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086311.702395IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.8E-233108IPR015300DNA-binding pseudobarrel domain
CDDcd100175.27E-14592No hitNo description
SMARTSM010191.1E-21695IPR003340B3 DNA binding domain
PfamPF023622.1E-91489IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.6E-20123221IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.02E-20129228IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086316.116130226IPR003340B3 DNA binding domain
CDDcd100171.20E-19130224No hitNo description
SMARTSM010191.3E-26131226IPR003340B3 DNA binding domain
PfamPF023622.8E-21131223IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.6E-22231328IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019365.1E-22234337IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086316.595236333IPR003340B3 DNA binding domain
CDDcd100174.17E-21236331No hitNo description
SMARTSM010198.9E-31237333IPR003340B3 DNA binding domain
PfamPF023627.2E-23238332IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.2E-18379484IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.16E-18381483IPR015300DNA-binding pseudobarrel domain
SMARTSM010191.3E-27387485IPR003340B3 DNA binding domain
PfamPF023621.4E-17387484IPR003340B3 DNA binding domain
PROSITE profilePS5086312.844387484IPR003340B3 DNA binding domain
CDDcd100171.74E-12392482No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000293anatomyguard cell
Sequence ? help Back to Top
Protein Sequence    Length: 490 aa     Download sequence    Send to blast
MANQHFFKPL LPGFHTHLRI PVAFFLKNIE GRYEQKTAEL RSDASKITWE VKIDGQRLTD  60
GWKEFALSHD LRIGDIVVFR QERDMSFHVT MLGPSCCEIQ YGSCSDEERN LEKKKNPNGE  120
AKSSSLDPSC FSANVAPSSL RYDLMLFPMG FVRENGVVGS GKIVLMNEKG RSWNFNLRQK  180
PSCGTVYVRG GWVSFCDANG LQAGDIYTFK LIKRGGTLVL RLLPKGAESC SLDPSCFVAN  240
VAPSTLRYDT LYLPKRFMRE NGVDKRRGEM ILMNEKGKSW TLDLKLKKSC GTSLIRRGWR  300
SFCSANGLRA GSIITFKLIK KSGTLVLCLL SNEPEEEVCS EANEVESLST DQESHEESSH  360
NEKISRRKEK KGRMIWKASS SPSENRFVTL NLTPYNILRS ALRLPIPFTR MNGINEETKM  420
TLLDKHGMKW LTTLRLVDYK RKRLGMVGGW KGFIQANGVK ANESIMLELI WEEETSCVLK  480
FCSKVKLAIK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.753010.0flower
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible257436_s_at0.0
Expression AtlasAT2G24645-
AtGenExpressAT2G24645-
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G24645.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G24645
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1175140.0AK117514.1 Arabidopsis thaliana At2g24650 mRNA for unknown protein, complete cds, clone: RAFL17-15-N14.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001189594.10.0transcriptional factor B3 family protein
SwissprotQ8GYM40.0REM14_ARATH; B3 domain-containing protein REM14
TrEMBLD7LIB20.0D7LIB2_ARALL; Transcriptional factor B3 family protein
STRINGAT2G24645.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP2682231
MalvidsOGEM20422261
Publications ? help Back to Top
  1. Seki M, et al.
    Functional annotation of a full-length Arabidopsis cDNA collection.
    Science, 2002. 296(5565): p. 141-5
    [PMID:11910074]