PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G24430.2
Common NameANAC038, ANAC039, NAC038
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NAC
Protein Properties Length: 316aa    MW: 35841.1 Da    PI: 8.4293
Description NAC domain containing protein 38
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G24430.2genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM176.19.8e-55161431128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kg 97 
                  lppGfrFhPtdeel+++yL +k+++++++  ++i++vd++k+ePw+Lp+k+k + kewyfFs rd+ky+tg r+nrat++gyWk+tgkdke++++ ++
  AT2G24430.2  16 LPPGFRFHPTDEELISYYLVNKIADQNFTG-KAIADVDLNKSEPWELPEKAKMGGKEWYFFSLRDRKYPTGVRTNRATNTGYWKTTGKDKEIFNStTS 112
                  79*************************999.88***************99999****************************************98788 PP

          NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                  elvg+kktLvfy+grap+gekt Wvmheyrl
  AT2G24430.2 113 ELVGMKKTLVFYRGRAPRGEKTCWVMHEYRL 143
                  89***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.48E-6312165IPR003441NAC domain
PROSITE profilePS5100560.91716165IPR003441NAC domain
PfamPF023651.3E-2817143IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007275Biological Processmulticellular organism development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009005anatomyroot
PO:0009025anatomyvascular leaf
PO:0009047anatomystem
PO:0020100anatomyhypocotyl
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
Sequence ? help Back to Top
Protein Sequence    Length: 316 aa     Download sequence    Send to blast
MEQGDHQQHK KEEEALPPGF RFHPTDEELI SYYLVNKIAD QNFTGKAIAD VDLNKSEPWE  60
LPEKAKMGGK EWYFFSLRDR KYPTGVRTNR ATNTGYWKTT GKDKEIFNST TSELVGMKKT  120
LVFYRGRAPR GEKTCWVMHE YRLHSKSSYR TSKQDEWVVC RVFKKTEATK KYISTSSSST  180
SHHHNNHTRA SILSTNNNNP NYSSDLLQLP PHLQPHPSLN INQSLMANAV HLAELSRVFR  240
ASTSTTMDSS HQQLMNYTHM PVSGLNLNLG GALVQPPPVV SLEDVAAVSA SYNGENGFGN  300
VEMSQCMDLD GYWPSY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B8e-581517116171NAC domain-containing protein 19
4dul_A8e-581517116171NAC domain-containing protein 19
1ut7_B8e-581517116171NO APICAL MERISTEM PROTEIN
1ut7_A8e-581517116171NO APICAL MERISTEM PROTEIN
1ut4_B8e-581517116171NO APICAL MERISTEM PROTEIN
1ut4_A8e-581517116171NO APICAL MERISTEM PROTEIN
3swp_D9e-581517119174NAC domain-containing protein 19
3swp_C9e-581517119174NAC domain-containing protein 19
3swp_B9e-581517119174NAC domain-containing protein 19
3swp_A9e-581517119174NAC domain-containing protein 19
3swm_D9e-581517119174NAC domain-containing protein 19
3swm_C9e-581517119174NAC domain-containing protein 19
3swm_B9e-581517119174NAC domain-containing protein 19
3swm_A9e-581517119174NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.391590.0root| seed
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible265685_at0.0
Expression AtlasAT2G24430-
AtGenExpressAT2G24430-
ATTED-IIAT2G24430-
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00277DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G24430.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G24430
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0064030.0AC006403.4 Arabidopsis thaliana chromosome 2 clone T28I24 map mi238, complete sequence.
GenBankCP0026850.0CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_850054.10.0NAC domain containing protein 38
RefseqNP_180019.10.0NAC domain containing protein 38
SwissprotQ9FRV42e-81NAC54_ARATH; Protein CUP-SHAPED COTYLEDON 1
TrEMBLQ9ZQ250.0Q9ZQ25_ARATH; NAC domain containing protein 38
STRINGAT2G24430.10.0(Arabidopsis thaliana)
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Folta KM,Pontin MA,Karlin-Neumann G,Bottini R,Spalding EP
    Genomic and physiological studies of early cryptochrome 1 action demonstrate roles for auxin and gibberellin in the control of hypocotyl growth by blue light.
    Plant J., 2003. 36(2): p. 203-14
    [PMID:14535885]
  3. Ooka H, et al.
    Comprehensive analysis of NAC family genes in Oryza sativa and Arabidopsis thaliana.
    DNA Res., 2003. 10(6): p. 239-47
    [PMID:15029955]
  4. Zhang X, et al.
    Cucumber mosaic virus-encoded 2b suppressor inhibits Arabidopsis Argonaute1 cleavage activity to counter plant defense.
    Genes Dev., 2006. 20(23): p. 3255-68
    [PMID:17158744]
  5. Efroni I, et al.
    Regulation of leaf maturation by chromatin-mediated modulation of cytokinin responses.
    Dev. Cell, 2013. 24(4): p. 438-45
    [PMID:23449474]