PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G23760.2
Common NameBLH4, F27L4.6, SAW2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family TALE
Protein Properties Length: 627aa    MW: 69271.1 Da    PI: 6.8755
Description BEL1-like homeodomain 4
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G23760.2genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.81e-094444811954
                  HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
     Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                  Fe   n+yps +++  LA+++gL+ +qV++WF N R +
  AT2G23760.2 444 FEHflNPYPSDADKHLLARQTGLSRNQVSNWFINARVR 481
                  665569******************************88 PP

2BELL123.77.4e-40302373172
         BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                  +r e+q++k+kLls+leeVd+rY++y+eq+q+v++sF++v+g+g+a pYt+lA+ka+SrhFrcLkda+a q+
  AT2G23760.2 302 DRIEHQRRKVKLLSMLEEVDRRYNHYCEQMQMVVNSFDQVMGYGAAVPYTTLAQKAMSRHFRCLKDAVAVQL 373
                  589******************************************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005742.4E-88232371IPR006563POX domain
PfamPF075264.6E-52238370IPR006563POX domain
PROSITE profilePS5007112.86422485IPR001356Homeobox domain
CDDcd000861.26E-12425486No hitNo description
SMARTSM003891.1E-9425489IPR001356Homeobox domain
SuperFamilySSF466891.21E-17426492IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.7E-28428491IPR009057Homeodomain-like
PfamPF059202.8E-18442481IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009965Biological Processleaf morphogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0009067anatomyfilament
PO:0009074anatomystyle
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020102anatomyportion of transmitting tissue
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 627 aa     Download sequence    Send to blast
MGLATTTSSM SQDYHHHQGI FSFSNGFHRS SSTTHQEEVD ESAVVSGAQI PVYETAGMLS  60
EMFAYPGGGG GGSGGEILDQ STKQLLEQQN RHNNNNNSTL HMLLPNHHQG FAFTDENTMQ  120
PQQQQHFTWP SSSSDHHQNR DMIGTVHVEG GKGLSLSLSS SLAAAKAEEY RSIYCAAVDG  180
TSSSSNASAH HHQFNQFKNL LLENSSSQHH HHQVVGHFGS SSSSPMAASS SIGGIYTLRN  240
SKYTKPAQEL LEEFCSVGRG HFKKNKLSRN NSNPNTTGGG GGGGSSSSAG TANDSPPLSP  300
ADRIEHQRRK VKLLSMLEEV DRRYNHYCEQ MQMVVNSFDQ VMGYGAAVPY TTLAQKAMSR  360
HFRCLKDAVA VQLKRSCELL GDKEAAGAAS SGLTKGETPR LRLLEQSLRQ QRAFHHMGMM  420
EQEAWRPQRG LPERSVNILR AWLFEHFLNP YPSDADKHLL ARQTGLSRNQ VSNWFINARV  480
RLWKPMVEEM YQQEAKEREE AEEENENQQQ QRRQQQTNNN DTKPNNNENN FTVITAQTPT  540
TMTSTHHEND SSFLSSVAAA SHGGSDAFTV ATCQQDVSDF HVDGDGVNVI RFGTKQTGDV  600
SLTLGLRHSG NIPDKNTSFS VRDFGDF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_B5e-16431488158Homeobox protein Meis1
4xrs_A5e-16431488158Homeobox protein Meis1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.126240.0seed
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible267298_at0.0
Expression AtlasAT2G23760-
AtGenExpressAT2G23760-
ATTED-IIAT2G23760-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in lateral organs. {ECO:0000269|PubMed:17873098}.
Functional Description ? help Back to Top
Source Description
TAIREncodes a member of the BEL family of homeodomain proteins. Plants doubly mutant for saw1/saw2 (blh2/blh4) have serrated leaves. BP is expressed in the serrated leaves, therefore saw2 and saw1 may act redundantly to repress BP in leaves.
UniProtTranscription factor that establishes leaf shape by repressing growth in specific subdomains of the leaf. Negatively regulates knox homeobox gene KNAT1/BP expression. {ECO:0000269|PubMed:17873098}.
Function -- GeneRIF ? help Back to Top
  1. These data suggest that BLH2/SAW1 and BLH4/SAW2 establish leaf shape by repressing growth in specific subdomains of the leaf at least in part by repressing expression of one or more of the KNOX genes.
    [PMID: 17873098]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G23760.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source Target Gene (A: Activate/R: Repress)
ATRM AT4G08150(R)
Interaction ? help Back to Top
Source Intact With
BioGRIDAT2G27220, AT2G35940, AT4G08150, AT4G32040, AT4G32980, AT4G36870, AT5G25220, AT5G41410, AT1G19700, AT1G23380, AT1G26260, AT1G62360, AT1G70510, AT1G75410
IntActSearch Q94KL5
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G23760
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY1420190.0AY142019.1 Arabidopsis thaliana At2g23760/F27L4.6 mRNA, complete cds.
GenBankAY0581790.0AY058179.1 Arabidopsis thaliana At2g23760/F27L4.6 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_179956.10.0BEL1-like homeodomain 4
RefseqNP_001031404.10.0BEL1-like homeodomain 4
RefseqNP_850044.10.0BEL1-like homeodomain 4
SwissprotQ94KL50.0BLH4_ARATH; BEL1-like homeodomain protein 4
TrEMBLD7LG220.0D7LG22_ARALL; Putative uncharacterized protein
STRINGAT2G23760.10.0(Arabidopsis thaliana)
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Boisson B,Giglione C,Meinnel T
    Unexpected protein families including cell defense components feature in the N-myristoylome of a higher eukaryote.
    J. Biol. Chem., 2003. 278(44): p. 43418-29
    [PMID:12912986]
  3. Oh S,Park S,Han KH
    Transcriptional regulation of secondary growth in Arabidopsis thaliana.
    J. Exp. Bot., 2003. 54(393): p. 2709-22
    [PMID:14585825]
  4. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  5. Smith HM,Campbell BC,Hake S
    Competence to respond to floral inductive signals requires the homeobox genes PENNYWISE and POUND-FOOLISH.
    Curr. Biol., 2004. 14(9): p. 812-7
    [PMID:15120075]
  6. Hackbusch J,Richter K,Müller J,Salamini F,Uhrig JF
    A central role of Arabidopsis thaliana ovate family proteins in networking and subcellular localization of 3-aa loop extension homeodomain proteins.
    Proc. Natl. Acad. Sci. U.S.A., 2005. 102(13): p. 4908-12
    [PMID:15781858]
  7. Lee BH,Henderson DA,Zhu JK
    The Arabidopsis cold-responsive transcriptome and its regulation by ICE1.
    Plant Cell, 2005. 17(11): p. 3155-75
    [PMID:16214899]
  8. Kumar R, et al.
    The Arabidopsis BEL1-LIKE HOMEODOMAIN proteins SAW1 and SAW2 act redundantly to regulate KNOX expression spatially in leaf margins.
    Plant Cell, 2007. 19(9): p. 2719-35
    [PMID:17873098]
  9. Magnani E,Hake S
    KNOX lost the OX: the Arabidopsis KNATM gene defines a novel class of KNOX transcriptional regulators missing the homeodomain.
    Plant Cell, 2008. 20(4): p. 875-87
    [PMID:18398054]
  10. Dortay H, et al.
    Toward an interaction map of the two-component signaling pathway of Arabidopsis thaliana.
    J. Proteome Res., 2008. 7(9): p. 3649-60
    [PMID:18642946]
  11. Colinas J,Schmidler SC,Bohrer G,Iordanov B,Benfey PN
    Intergenic and genic sequence lengths have opposite relationships with respect to gene expression.
    PLoS ONE, 2008. 3(11): p. e3670
    [PMID:18989364]
  12. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]