PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G23660.2
Common NameASL2, F26B6.31, F27L4.15, LBD10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family LBD
Protein Properties Length: 311aa    MW: 34780.1 Da    PI: 4.2924
Description LOB domain-containing protein 10
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G23660.2genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260136.31.1e-4251041100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk+lrrkC+++Cv+apyfp ++p+kf +vh++FGasnv+k+l++lp+++red+++sl+yeAear+rdP+yG+vg+i+ lqq l++ +++l ++k
  AT2G23660.2   5 PCAACKLLRRKCTQECVFAPYFPPTNPQKFIFVHRVFGASNVTKILNDLPPDQREDTVNSLFYEAEARIRDPIYGCVGLISFLQQYLKKIQQDLLTAK 102
                  7********************************************************************************************99998 PP

       DUF260  99 ee 100
                  ee
  AT2G23660.2 103 EE 104
                  86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0381557.1E-1242309IPR017414LOB domain-containing protein 10/36/41
PROSITE profilePS5089127.1164105IPR004883Lateral organ boundaries, LOB
PfamPF031952.9E-415102IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008150Biological Processbiological_process
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000084anatomyplant sperm cell
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0025022anatomycollective leaf structure
PO:0025195anatomypollen tube cell
PO:0025281anatomypollen
PO:0001016developmental stageL mature pollen stage
PO:0001017developmental stageM germinated pollen stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 311 aa     Download sequence    Send to blast
MASTPCAACK LLRRKCTQEC VFAPYFPPTN PQKFIFVHRV FGASNVTKIL NDLPPDQRED  60
TVNSLFYEAE ARIRDPIYGC VGLISFLQQY LKKIQQDLLT AKEELVGYLG PDAVIPPPYL  120
PPIGNNPPPN FMMSMEGMPP GVIPQGEPLM IREPNMSQQH HHQQPQDEQL QFIASDAQRM  180
AAMMLERGDQ QGMFNGYGID NNGSVTATGF NQMDVNDQGA GGSLSGPSLA LGSFGDAYQM  240
GQETEHGHIN HDQLQTQLML QPPLQEGQEQ TEEGQFLMQP MGQENLHDEE EEEELEPPVK  300
WRMSENKEAS F
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-4621088114LOB family transfactor Ramosa2.1
5ly0_B1e-4621088114LOB family transfactor Ramosa2.1
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible267296_at0.0
Expression AtlasAT2G23660-
AtGenExpressAT2G23660-
ATTED-IIAT2G23660-
Function -- GeneRIF ? help Back to Top
  1. A combinatorial role of LBD10 with LBD27 is crucial for male gametophyte development in Arabidopsis. LBD10 and LBD27 interact to form a heterodimer for nuclear localization.
    [PMID: 25611322]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G23660.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
BioGRIDAT2G23660, AT3G47870
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G23660
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4738350.0AB473835.1 Arabidopsis thaliana ASL2 mRNA for ASYMMETRIC LEAVES2-like 2 protein, complete cds.
GenBankAC0030400.0AC003040.3 Arabidopsis thaliana chromosome 2 clone F26B6 map CIC06C07, complete sequence.
GenBankAC0044820.0AC004482.3 Arabidopsis thaliana chromosome 2 clone F27L4 map CIC06C07, complete sequence.
GenBankCP0026850.0CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001154530.10.0LOB domain-containing protein 10
RefseqNP_001323843.10.0LOB domain-containing protein 10
RefseqNP_179946.10.0LOB domain-containing protein 10
SwissprotO648360.0LBD10_ARATH; LOB domain-containing protein 10
TrEMBLA0A178VXQ40.0A0A178VXQ4_ARATH; LBD10
STRINGAT2G23660.20.0(Arabidopsis thaliana)
Publications ? help Back to Top
  1. Iwakawa H, et al.
    The ASYMMETRIC LEAVES2 gene of Arabidopsis thaliana, required for formation of a symmetric flat leaf lamina, encodes a member of a novel family of proteins characterized by cysteine repeats and a leucine zipper.
    Plant Cell Physiol., 2002. 43(5): p. 467-78
    [PMID:12040093]
  2. Shuai B,Reynaga-Peña CG,Springer PS
    The lateral organ boundaries gene defines a novel, plant-specific gene family.
    Plant Physiol., 2002. 129(2): p. 747-61
    [PMID:12068116]
  3. Wang Y, et al.
    Transcriptome analyses show changes in gene expression to accompany pollen germination and tube growth in Arabidopsis.
    Plant Physiol., 2008. 148(3): p. 1201-11
    [PMID:18775970]
  4. Matsumura Y,Iwakawa H,Machida Y,Machida C
    Characterization of genes in the ASYMMETRIC LEAVES2/LATERAL ORGAN BOUNDARIES (AS2/LOB) family in Arabidopsis thaliana, and functional and molecular comparisons between AS2 and other family members.
    Plant J., 2009. 58(3): p. 525-37
    [PMID:19154202]
  5. Efroni I, et al.
    Regulation of leaf maturation by chromatin-mediated modulation of cytokinin responses.
    Dev. Cell, 2013. 24(4): p. 438-45
    [PMID:23449474]
  6. Kim MJ,Kim M,Lee MR,Park SK,Kim J
    LATERAL ORGAN BOUNDARIES DOMAIN (LBD)10 interacts with SIDECAR POLLEN/LBD27 to control pollen development in Arabidopsis.
    Plant J., 2015. 81(5): p. 794-809
    [PMID:25611322]
  7. Kim MJ,Kim M,Kim J
    Combinatorial interactions between LBD10 and LBD27 are essential for male gametophyte development in Arabidopsis.
    Plant Signal Behav, 2015. 10(8): p. e1044193
    [PMID:26252070]
  8. Kim M,Kim MJ,Pandey S,Kim J
    Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development.
    Plant Cell Physiol., 2016. 57(11): p. 2291-2299
    [PMID:27519310]