PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G22800.1
Common NameHAT9, T20K9.1, T30L20.6
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family HD-ZIP
Protein Properties Length: 274aa    MW: 29877.6 Da    PI: 7.6794
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G22800.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.93.5e-18112166256
                  T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
     Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                  rk+ ++tk+q   Lee F+ +++++ ++++ LA++l+L  rqV vWFqNrRa+ k
  AT2G22800.1 112 RKKLRLTKQQSALLEESFKDHSTLNPKQKQVLARQLNLRPRQVEVWFQNRRARTK 166
                  788899***********************************************98 PP

2HD-ZIP_I/II121.54.2e-39112201191
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                  +kk+rl+k+q++lLEesF+ +++L+p++K+ lar+L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lk+++++l++en rL+ke +eL+ +l
  AT2G22800.1 112 RKKLRLTKQQSALLEESFKDHSTLNPKQKQVLARQLNLRPRQVEVWFQNRRARTKLKQTEVDCEFLKKCCETLADENIRLQKEIQELK-TL 201
                  69*************************************************************************************9.54 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007116.908108168IPR001356Homeobox domain
SMARTSM003893.7E-15110172IPR001356Homeobox domain
SuperFamilySSF466897.7E-18110176IPR009057Homeodomain-like
CDDcd000864.70E-16112169No hitNo description
PfamPF000461.3E-15112166IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.607.3E-17112166IPR009057Homeodomain-like
PROSITE patternPS000270143166IPR017970Homeobox, conserved site
SMARTSM003407.6E-25168211IPR003106Leucine zipper, homeobox-associated
PfamPF021832.5E-9168201IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000293anatomyguard cell
PO:0009005anatomyroot
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 274 aa     Download sequence    Send to blast
MGFDDTCNTG LVLGLGPSPI PNNYNSTIRQ SSVYKLEPSL TLCLSGDPSV TVVTGADQLC  60
RQTSSHSGVS SFSSGRVVKR ERDGGEESPE EEEMTERVIS DYHEDEEGIS ARKKLRLTKQ  120
QSALLEESFK DHSTLNPKQK QVLARQLNLR PRQVEVWFQN RRARTKLKQT EVDCEFLKKC  180
CETLADENIR LQKEIQELKT LKLTQPFYMH MPASTLTKCP SCERIGGGGG GNGGGGGGSG  240
ATAVIVDGST AKGAFSISSK PHFFNPFTNP SAAC
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1160168RRARTKLKQ
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible266824_at0.0
Expression AtlasAT2G22800-
AtGenExpressAT2G22800-
ATTED-IIAT2G22800-
Functional Description ? help Back to Top
Source Description
TAIREncodes homeobox protein HAT9.
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G22800.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G22800
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2292180.0AK229218.1 Arabidopsis thaliana mRNA for homeobox protein, complete cds, clone: RAFL16-50-N10.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_179865.10.0Homeobox-leucine zipper protein family
SwissprotP466030.0HAT9_ARATH; Homeobox-leucine zipper protein HAT9
TrEMBLA0A178VZE80.0A0A178VZE8_ARATH; HAT9
STRINGAT2G22800.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16712886
Representative plantOGRP19616156
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Henriksson E, et al.
    Homeodomain leucine zipper class I genes in Arabidopsis. Expression patterns and phylogenetic relationships.
    Plant Physiol., 2005. 139(1): p. 509-18
    [PMID:16055682]
  3. Fleury D, et al.
    The Arabidopsis thaliana homolog of yeast BRE1 has a function in cell cycle regulation during early leaf and root growth.
    Plant Cell, 2007. 19(2): p. 417-32
    [PMID:17329565]
  4. Shin R,Jez JM,Basra A,Zhang B,Schachtman DP
    14-3-3 proteins fine-tune plant nutrient metabolism.
    FEBS Lett., 2011. 585(1): p. 143-7
    [PMID:21094157]
  5. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  6. Schena M,Davis RW
    Structure of homeobox-leucine zipper genes suggests a model for the evolution of gene families.
    Proc. Natl. Acad. Sci. U.S.A., 1994. 91(18): p. 8393-7
    [PMID:7915839]