PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G22430.1
Common NameATHB6, ATHB-6, F14M13.17, HB6
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family HD-ZIP
Protein Properties Length: 311aa    MW: 35017.6 Da    PI: 4.4705
Description homeobox protein 6
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G22430.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.32.6e-1862115356
                  --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
     Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                  k+++++ +q+++Le+ Fe ++++  e++ +LA++lgL+ rqV vWFqNrRa++k
  AT2G22430.1  62 KKRRLSINQVKALEKNFELENKLEPERKVKLAQELGLQPRQVAVWFQNRRARWK 115
                  5568999**********************************************9 PP

2HD-ZIP_I/II128.92.1e-4161153193
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                  ekkrrls +qvk+LE++Fe e+kLeperKv+la+eLglqprqvavWFqnrRAR+ktkqlEkdy +Lk++yd+l+++ ++L++++e+L +e+++
  AT2G22430.1  61 EKKRRLSINQVKALEKNFELENKLEPERKVKLAQELGLQPRQVAVWFQNRRARWKTKQLEKDYGVLKTQYDSLRHNFDSLRRDNESLLQEISK 153
                  69*************************************************************************************999976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007116.90857117IPR001356Homeobox domain
SuperFamilySSF466892.01E-1859119IPR009057Homeodomain-like
SMARTSM003893.4E-1760121IPR001356Homeobox domain
PfamPF000461.4E-1562115IPR001356Homeobox domain
CDDcd000862.42E-1562118No hitNo description
Gene3DG3DSA:1.10.10.603.2E-1964124IPR009057Homeodomain-like
PRINTSPR000318.7E-68897IPR000047Helix-turn-helix motif
PROSITE patternPS00027092115IPR017970Homeobox, conserved site
PRINTSPR000318.7E-697113IPR000047Helix-turn-helix motif
PfamPF021835.4E-17117158IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009788Biological Processnegative regulation of abscisic acid-activated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000017anatomyvascular leaf primordium
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009001anatomyfruit
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020121anatomylateral root
PO:0020127anatomyprimary root
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 311 aa     Download sequence    Send to blast
MMKRLSSSDS VGGLISLCPT TSTDEQSPRR YGGREFQSML EGYEEEEEAI VEERGHVGLS  60
EKKRRLSINQ VKALEKNFEL ENKLEPERKV KLAQELGLQP RQVAVWFQNR RARWKTKQLE  120
KDYGVLKTQY DSLRHNFDSL RRDNESLLQE ISKLKTKLNG GGGEEEEEEN NAAVTTESDI  180
SVKEEEVSLP EKITEAPSSP PQFLEHSDGL NYRSFTDLRD LLPLKAAASS FAAAAGSSDS  240
SDSSALLNEE SSSNVTVAAP VTVPGGNFFQ FVKMEQTEDH EDFLSGEEAC EFFSDEQPPS  300
LHWYSTVDHW N
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1109117RRARWKTKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.252570.0bud| cell culture| floral meristem| flower| leaf| root
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO306817080.0
Genevisible264006_at0.0
Expression AtlasAT2G22430-
AtGenExpressAT2G22430-
ATTED-IIAT2G22430-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:10527431, ECO:0000269|PubMed:16055682}.
Functional Description ? help Back to Top
Source Description
TAIREncodes a homeodomain leucine zipper class I (HD-Zip I) protein that is a target of the protein phosphatase ABI1 and regulates hormone responses in Arabidopsis.
UniProtTranscription activator that may act as growth regulators in response to water deficit. Interacts with the core sequence 5'-CAATTATTA-3' of promoters in response to ABA and in an ABI1-dependent manner. Involved in the negative regulation of the ABA signaling pathway. {ECO:0000269|PubMed:10527431, ECO:0000269|PubMed:12065416}.
Function -- GeneRIF ? help Back to Top
  1. MATH-BTB proteins directly interact with and target for proteasomal degradation the class I homeobox-leucine zipper (HD-ZIP) transcription factor ATHB6, which was previously identified as a negative regulator of abscisic acid responses.
    [PMID: 22172674]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00271DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G22430.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By water deficit, by abscisic acid (ABA) and by salt stress. Self expression regulation. {ECO:0000269|PubMed:10527431, ECO:0000269|PubMed:12065416, ECO:0000269|PubMed:16055682}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDabscisic acid
Interaction ? help Back to Top
Source Intact With
BioGRIDAT5G65310, AT1G10585
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G22430
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0605690.0AY060569.1 Arabidopsis thaliana At2g22430/F14M13.17 mRNA, complete cds.
GenBankAY0638190.0AY063819.1 Arabidopsis thaliana putative homeodomain transcription factor ATHB-6 (At2g22430) mRNA, complete cds.
GenBankAY0944570.0AY094457.1 Arabidopsis thaliana At2g22430/F14M13.17 mRNA, complete cds.
GenBankAY1229030.0AY122903.1 Arabidopsis thaliana At2g22430/F14M13.17 mRNA, complete cds.
GenBankX670340.0X67034.1 A.thaliana mRNA Athb-6.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_565536.10.0homeobox protein 6
SwissprotP466680.0ATHB6_ARATH; Homeobox-leucine zipper protein ATHB-6
TrEMBLA0A178VSN90.0A0A178VSN9_ARATH; HB6
STRINGAT2G22430.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM54528143
Representative plantOGRP12916189
Publications ? help Back to Top
  1. Söderman E,Hjellström M,Fahleson J,Engström P
    The HD-Zip gene ATHB6 in Arabidopsis is expressed in developing leaves, roots and carpels and up-regulated by water deficit conditions.
    Plant Mol. Biol., 1999. 40(6): p. 1073-83
    [PMID:10527431]
  2. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  3. Johannesson H,Wang Y,Engström P
    DNA-binding and dimerization preferences of Arabidopsis homeodomain-leucine zipper transcription factors in vitro.
    Plant Mol. Biol., 2001. 45(1): p. 63-73
    [PMID:11247607]
  4. Himmelbach A,Hoffmann T,Leube M,Höhener B,Grill E
    Homeodomain protein ATHB6 is a target of the protein phosphatase ABI1 and regulates hormone responses in Arabidopsis.
    EMBO J., 2002. 21(12): p. 3029-38
    [PMID:12065416]
  5. Bray EA
    Classification of genes differentially expressed during water-deficit stress in Arabidopsis thaliana: an analysis using microarray and differential expression data.
    Ann. Bot., 2002. 89 Spec No: p. 803-11
    [PMID:12102506]
  6. Gutierrez RA,Ewing RM,Cherry JM,Green PJ
    Identification of unstable transcripts in Arabidopsis by cDNA microarray analysis: rapid decay is associated with a group of touch- and specific clock-controlled genes.
    Proc. Natl. Acad. Sci. U.S.A., 2002. 99(17): p. 11513-8
    [PMID:12167669]
  7. Menges M,Hennig L,Gruissem W,Murray JA
    Cell cycle-regulated gene expression in Arabidopsis.
    J. Biol. Chem., 2002. 277(44): p. 41987-2002
    [PMID:12169696]
  8. Vlieghe K, et al.
    Microarray analysis of E2Fa-DPa-overexpressing plants uncovers a cross-talking genetic network between DNA replication and nitrogen assimilation.
    J. Cell. Sci., 2003. 116(Pt 20): p. 4249-59
    [PMID:12953064]
  9. Chen IP,Haehnel U,Altschmied L,Schubert I,Puchta H
    The transcriptional response of Arabidopsis to genotoxic stress - a high-density colony array study (HDCA).
    Plant J., 2003. 35(6): p. 771-86
    [PMID:12969430]
  10. Oh S,Park S,Han KH
    Transcriptional regulation of secondary growth in Arabidopsis thaliana.
    J. Exp. Bot., 2003. 54(393): p. 2709-22
    [PMID:14585825]
  11. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  12. Hu W,Wang Y,Bowers C,Ma H
    Isolation, sequence analysis, and expression studies of florally expressed cDNAs in Arabidopsis.
    Plant Mol. Biol., 2003. 53(4): p. 545-63
    [PMID:15010618]
  13. Ko JH,Han KH,Park S,Yang J
    Plant body weight-induced secondary growth in Arabidopsis and its transcription phenotype revealed by whole-transcriptome profiling.
    Plant Physiol., 2004. 135(2): p. 1069-83
    [PMID:15194820]
  14. Gong W, et al.
    Genome-wide ORFeome cloning and analysis of Arabidopsis transcription factor genes.
    Plant Physiol., 2004. 135(2): p. 773-82
    [PMID:15208423]
  15. Kang JG,Pyo YJ,Cho JW,Cho MH
    Comparative proteome analysis of differentially expressed proteins induced by K+ deficiency in Arabidopsis thaliana.
    Proteomics, 2004. 4(11): p. 3549-59
    [PMID:15449379]
  16. Hampton CR, et al.
    Cesium toxicity in Arabidopsis.
    Plant Physiol., 2004. 136(3): p. 3824-37
    [PMID:15489280]
  17. Lu Y,Zhu J,Liu P
    A two-step strategy for detecting differential gene expression in cDNA microarray data.
    Curr. Genet., 2005. 47(2): p. 121-31
    [PMID:15688252]
  18. Nagata T,Yamada H,Du Z,Todoriki S,Kikuchi S
    Microarray analysis of genes that respond to gamma-irradiation in Arabidopsis.
    J. Agric. Food Chem., 2005. 53(4): p. 1022-30
    [PMID:15713015]
  19. Henriksson E, et al.
    Homeodomain leucine zipper class I genes in Arabidopsis. Expression patterns and phylogenetic relationships.
    Plant Physiol., 2005. 139(1): p. 509-18
    [PMID:16055682]
  20. Lidder P,Guti
    Circadian control of messenger RNA stability. Association with a sequence-specific messenger RNA decay pathway.
    Plant Physiol., 2005. 138(4): p. 2374-85
    [PMID:16055688]
  21. Vergnolle C, et al.
    The cold-induced early activation of phospholipase C and D pathways determines the response of two distinct clusters of genes in Arabidopsis cell suspensions.
    Plant Physiol., 2005. 139(3): p. 1217-33
    [PMID:16258011]
  22. Deng X, et al.
    A homeodomain leucine zipper gene from Craterostigma plantagineum regulates abscisic acid responsive gene expression and physiological responses.
    Plant Mol. Biol., 2006. 61(3): p. 469-89
    [PMID:16830180]
  23. Nemhauser JL,Hong F,Chory J
    Different plant hormones regulate similar processes through largely nonoverlapping transcriptional responses.
    Cell, 2006. 126(3): p. 467-75
    [PMID:16901781]
  24. Fleury D, et al.
    The Arabidopsis thaliana homolog of yeast BRE1 has a function in cell cycle regulation during early leaf and root growth.
    Plant Cell, 2007. 19(2): p. 417-32
    [PMID:17329565]
  25. Willems G, et al.
    The genetic basis of zinc tolerance in the metallophyte Arabidopsis halleri ssp. halleri (Brassicaceae): an analysis of quantitative trait loci.
    Genetics, 2007. 176(1): p. 659-74
    [PMID:17409091]
  26. Soitamo AJ,Piippo M,Allahverdiyeva Y,Battchikova N,Aro EM
    Light has a specific role in modulating Arabidopsis gene expression at low temperature.
    BMC Plant Biol., 2008. 8: p. 13
    [PMID:18230142]
  27. Shin R,Jez JM,Basra A,Zhang B,Schachtman DP
    14-3-3 proteins fine-tune plant nutrient metabolism.
    FEBS Lett., 2011. 585(1): p. 143-7
    [PMID:21094157]
  28. Lechner E, et al.
    MATH/BTB CRL3 receptors target the homeodomain-leucine zipper ATHB6 to modulate abscisic acid signaling.
    Dev. Cell, 2011. 21(6): p. 1116-28
    [PMID:22172674]
  29. Kouno T,Ezaki B
    Multiple regulation of Arabidopsis AtGST11 gene expression by four transcription factors under abiotic stresses.
    Physiol Plant, 2013. 148(1): p. 97-104
    [PMID:23009097]
  30. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  31. Lumba S, et al.
    A mesoscale abscisic acid hormone interactome reveals a dynamic signaling landscape in Arabidopsis.
    Dev. Cell, 2014. 29(3): p. 360-72
    [PMID:24823379]
  32. Song L, et al.
    A transcription factor hierarchy defines an environmental stress response network.
    Science, 2017.
    [PMID:27811239]
  33. S
    Expression patterns of novel genes encoding homeodomain leucine-zipper proteins in Arabidopsis thaliana.
    Plant Mol. Biol., 1994. 26(1): p. 145-54
    [PMID:7948864]