PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G21900.1
Common NameATWRKY59, F7D8.22, WRKY59
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family WRKY
Protein Properties Length: 202aa    MW: 23253.6 Da    PI: 6.09
Description WRKY DNA-binding protein 59
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G21900.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY96.81.4e-30108166159
                  ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
         WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                  ldDgy+WrKYG+K+++gs+fpr+Y++C+s++C+vkkk+er++++p+++ +tYeg+Hnh+
  AT2G21900.1 108 LDDGYKWRKYGKKPITGSPFPRHYHKCSSPDCNVKKKIERDTNNPDYILTTYEGRHNHP 166
                  59********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.809.3E-28101168IPR003657WRKY domain
PROSITE profilePS5081128.529103168IPR003657WRKY domain
SuperFamilySSF1182901.83E-25104168IPR003657WRKY domain
SMARTSM007743.2E-31108167IPR003657WRKY domain
PfamPF031064.4E-22109166IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 202 aa     Download sequence    Send to blast
MNYPSNPNPS STDFTEFFKF DDFDDTFEKI MEEIGREDHS SSPTLSWSSS EKLVAAEITS  60
PLQTSLATSP MSFEIGDKDE IKKRKRHKED PIIHVFKTKS SIDEKVALDD GYKWRKYGKK  120
PITGSPFPRH YHKCSSPDCN VKKKIERDTN NPDYILTTYE GRHNHPSPSV VYCDSDDFDL  180
NSLNNWSFQT ANTYSFSHSA PY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A2e-2396169878Probable WRKY transcription factor 4
1wj2_A2e-2396169878Probable WRKY transcription factor 4
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible263893_at0.0
Expression AtlasAT2G21900-
AtGenExpressAT2G21900-
Functional Description ? help Back to Top
Source Description
TAIRmember of WRKY Transcription Factor; Group II-c
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00270DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G21900.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Interaction ? help Back to Top
Source Intact With
BioGRIDAT1G10585
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G21900
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0252610.0BT025261.1 Arabidopsis thaliana At2g21900 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_850019.11e-149putative WRKY transcription factor 59
SwissprotQ9SJ091e-151WRK59_ARATH; Probable WRKY transcription factor 59
TrEMBLQ1LYW51e-149Q1LYW5_ARATH; At2g21900
STRINGAT2G21900.11e-148(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1417875
MalvidsOGEM138351726
Publications ? help Back to Top
  1. Eulgem T,Rushton PJ,Robatzek S,Somssich IE
    The WRKY superfamily of plant transcription factors.
    Trends Plant Sci., 2000. 5(5): p. 199-206
    [PMID:10785665]
  2. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  3. Hass C, et al.
    The response regulator 2 mediates ethylene signalling and hormone signal integration in Arabidopsis.
    EMBO J., 2004. 23(16): p. 3290-302
    [PMID:15282545]
  4. Ma S,Gong Q,Bohnert HJ
    Dissecting salt stress pathways.
    J. Exp. Bot., 2006. 57(5): p. 1097-107
    [PMID:16510518]
  5. Lumba S, et al.
    A mesoscale abscisic acid hormone interactome reveals a dynamic signaling landscape in Arabidopsis.
    Dev. Cell, 2014. 29(3): p. 360-72
    [PMID:24823379]