PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G21240.2
Common NameATBPC4, BBR, BPC4, F7O24.4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family BBR-BPC
Protein Properties Length: 296aa    MW: 33306.8 Da    PI: 9.4974
Description basic pentacysteine 4
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G21240.2genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind354.62.2e-10812961301
    GAGA_bind   1 mdddgsre..rnkg.yye................paaslkenlglqlmssiaerdakirernlalsekkaavaerdmaflqrdkalaernkalverdn 79 
                  m++ g+++  r+k+ y++                ++++l   +++++ms++aerda+++ern+a+s+kk+ava+rd+a++qrdkal+er+kal+erdn
  AT2G21240.2   1 MENGGQYDnaRFKPdYFKgaqsmwnmipqhqikeQHNALV--MNKKIMSILAERDAAVHERNQAVSAKKEAVAARDEALQQRDKALSERDKALIERDN 96 
                  9999999999****9999*********9888765446666..99****************************************************** PP

    GAGA_bind  80 kllalllvenslasalpvgvqvlsgtksidslqqlsepqledsavelreeeklealpieeaaeeakekkkkkkrqrakkpkekkak..kkkkkseksk 175
                  +++al+++ensl++a       lsg k++d          +d+++++ e +kle++p+++ ++e++++k ++kr     +ke+k+   k+kk +e+ +
  AT2G21240.2  97 AYAALQHHENSLNFA-------LSGGKCVD----------GDDCFGIGEPHKLEVFPLSTIPPEVTNTKVVNKR-----KKENKQGlsKVKKVGEDLN 172
                  **********96655.......59*****9..........799**************************99943.....333444333788889999* PP

    GAGA_bind 176 kkvkkesaderskaekksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmSqgafkklLekLa 273
                  ++v +++  ++s+++++s+d++ln v++De+t+PvP+CsCtG++rqCYkWGnGGWqS+CCttt+S+yPLP+++++r++R++grKmS+++f++lL++L+
  AT2G21240.2 173 RRVPAPG--KKSRTDWDSQDVGLNLVTFDETTMPVPMCSCTGSTRQCYKWGNGGWQSSCCTTTLSQYPLPQMPNKRHSRMGGRKMSGNVFSRLLSRLS 268
                  *******..57*************************************************************************************** PP

    GAGA_bind 274 aeGydlsnpvDLkdhWAkHGtnkfvtir 301
                  aeGydls+pvDLkd+WA+HGtn+++ti+
  AT2G21240.2 269 AEGYDLSCPVDLKDYWARHGTNRYITIK 296
                  ***************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF062173.2E-941296IPR010409GAGA-binding transcriptional activator
SMARTSM012262.3E-1721296IPR010409GAGA-binding transcriptional activator
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0050793Biological Processregulation of developmental process
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000084anatomyplant sperm cell
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 296 aa     Download sequence    Send to blast
MENGGQYDNA RFKPDYFKGA QSMWNMIPQH QIKEQHNALV MNKKIMSILA ERDAAVHERN  60
QAVSAKKEAV AARDEALQQR DKALSERDKA LIERDNAYAA LQHHENSLNF ALSGGKCVDG  120
DDCFGIGEPH KLEVFPLSTI PPEVTNTKVV NKRKKENKQG LSKVKKVGED LNRRVPAPGK  180
KSRTDWDSQD VGLNLVTFDE TTMPVPMCSC TGSTRQCYKW GNGGWQSSCC TTTLSQYPLP  240
QMPNKRHSRM GGRKMSGNVF SRLLSRLSAE GYDLSCPVDL KDYWARHGTN RYITIK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.395860.0flower| leaf| seed
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1865019980.0
Genevisible263413_at0.0
Expression AtlasAT2G21240-
AtGenExpressAT2G21240-
ATTED-IIAT2G21240-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in seedlings, leaves and pistils. Detected in the base of flowers and tips of carpels, in sepal and petal vasculature, in anthers, in young rosette, in the lateral and primary roots, and in the whole ovule. {ECO:0000269|PubMed:14731261, ECO:0000269|PubMed:21435046}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator that specifically binds to GA-rich elements (GAGA-repeats) present in regulatory sequences of genes involved in developmental processes. {ECO:0000269|PubMed:14731261}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G21240.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
BioGRIDAT2G21240, AT5G42520
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G21240
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2290900.0AK229090.1 Arabidopsis thaliana mRNA for hypothetical protein, complete cds, clone: RAFL16-37-J01.
GenBankAK3171650.0AK317165.1 Arabidopsis thaliana AT2G21240 mRNA, complete cds, clone: RAFL21-54-A06.
GenBankAY0845540.0AY084554.1 Arabidopsis thaliana clone 111536 mRNA, complete sequence.
GenBankBT0261090.0BT026109.1 Arabidopsis thaliana At2g21240 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_565503.10.0basic pentacysteine 4
RefseqNP_850012.10.0basic pentacysteine 4
SwissprotQ8S8C60.0BPC4_ARATH; Protein BASIC PENTACYSTEINE4
TrEMBLA0A178VSW90.0A0A178VSW9_ARATH; BPC4
STRINGAT2G21240.10.0(Arabidopsis thaliana)
Publications ? help Back to Top
  1. Meister RJ, et al.
    Definition and interactions of a positive regulatory element of the Arabidopsis INNER NO OUTER promoter.
    Plant J., 2004. 37(3): p. 426-38
    [PMID:14731261]
  2. Fabro G, et al.
    Genome-wide expression profiling Arabidopsis at the stage of Golovinomyces cichoracearum haustorium formation.
    Plant Physiol., 2008. 146(3): p. 1421-39
    [PMID:18218973]
  3. Wanke D, et al.
    Alanine zipper-like coiled-coil domains are necessary for homotypic dimerization of plant GAGA-factors in the nucleus and nucleolus.
    PLoS ONE, 2011. 6(2): p. e16070
    [PMID:21347358]
  4. Monfared MM, et al.
    Overlapping and antagonistic activities of BASIC PENTACYSTEINE genes affect a range of developmental processes in Arabidopsis.
    Plant J., 2011. 66(6): p. 1020-31
    [PMID:21435046]
  5. Klopffleisch K, et al.
    Arabidopsis G-protein interactome reveals connections to cell wall carbohydrates and morphogenesis.
    Mol. Syst. Biol., 2011. 7: p. 532
    [PMID:21952135]