PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G20110.1
Common NameT2G17.9, TCX6
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family CPP
Protein Properties Length: 571aa    MW: 61312.7 Da    PI: 8.1891
Description Tesmin/TSO1-like CXC domain-containing protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G20110.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR45.71.3e-14116156142
          TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkeek 42 
                  ++kk+CnCk+s+Clk+YCeCfa+g++C+  C+C +C+N+ e+
  AT2G20110.1 116 QKKKQCNCKHSRCLKLYCECFASGTYCDG-CNCVNCFNNVEN 156
                  589**************************.********9875 PP

2TCR51.61.9e-16201240140
          TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                  +++kgC+Ckks ClkkYCeCf+a+  Cse+CkC dCkN e
  AT2G20110.1 201 RHNKGCHCKKSGCLKKYCECFQANILCSENCKCLDCKNFE 240
                  589***********************************65 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011141.5E-16116156IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163436.697117241IPR005172CRC domain
PfamPF036387.1E-11118153IPR005172CRC domain
SMARTSM011141.0E-19201242IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.1E-12204239IPR005172CRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007275Biological Processmulticellular organism development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046872Molecular Functionmetal ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000005anatomycultured plant cell
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 571 aa     Download sequence    Send to blast
MGEGEEGDKF PPKTDEVTQE SMKSARQLDF TGGSSDVEHS HSNQASSMAA ASIPSPIVTV  60
TRPIITSQAP PTVATPIPPP PQSQGIILHV PIRHPRPESP NSMPRPAGET RDGTPQKKKQ  120
CNCKHSRCLK LYCECFASGT YCDGCNCVNC FNNVENEPAR RQAVESTLER NPNAFRPKIA  180
ASPHGGRDNR EEVGDVVMLA RHNKGCHCKK SGCLKKYCEC FQANILCSEN CKCLDCKNFE  240
GSEVRQSLFH GEHSHNLAYL QHANAAITGA IGSSGFASAP PPKRRKGQEI FFNQGTKDSS  300
THRLGQANNG RTTSSQTGSR AGGNASLGPS KVVYKSLLAN IIKPMDVKAL CSVLVAVAGE  360
AAKTLTEKRL ANQKETSVAS SVQDQGHVNN KAEKSGLEDS NADGSKGRSL SPETLALMCD  420
ERDTMLMVAA SPNCSVEPTS QLPNGQDQVY AEQEKVVLTK FRDCLNRIIS CGEVKESNCS  480
MSRMDLDTPV QTTVRIDPVV QQAPVANGVS QTAKQPSQLN TTTPNTSSQT ANGVSQTAKQ  540
PSQLTTTTTT PNTSSQTHLH KTPALSEKKD L
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A7e-321082501132Protein lin-54 homolog
5fd3_B7e-321082501132Protein lin-54 homolog
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.397430.0flower
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible265592_at0.0
Expression AtlasAT2G20110-
AtGenExpressAT2G20110-
ATTED-IIAT2G20110-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Ubiquitous but expressed mostly in flowers. {ECO:0000269|PubMed:18057042}.
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00269DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G20110.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Interaction ? help Back to Top
Source Intact With
IntActSearch Q9SL70
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G20110
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4935560.0AB493556.1 Arabidopsis thaliana At2g20110 mRNA for hypothetical protein, partial cds, clone: RAAt2g20110.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_179601.10.0Tesmin/TSO1-like CXC domain-containing protein
SwissprotQ9SL700.0TCX6_ARATH; Protein tesmin/TSO1-like CXC 6
TrEMBLA0A178VQM80.0A0A178VQM8_ARATH; Uncharacterized protein
STRINGAT2G20110.20.0(Arabidopsis thaliana)
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Xiao YL,Malik M,Whitelaw CA,Town CD
    Cloning and sequencing of cDNAs for hypothetical genes from chromosome 2 of Arabidopsis.
    Plant Physiol., 2002. 130(4): p. 2118-28
    [PMID:12481096]
  3. Parker G,Schofield R,Sundberg B,Turner S
    Isolation of COV1, a gene involved in the regulation of vascular patterning in the stem of Arabidopsis.
    Development, 2003. 130(10): p. 2139-48
    [PMID:12668628]
  4. Zhang L, et al.
    Conservation of noncoding microsatellites in plants: implication for gene regulation.
    BMC Genomics, 2006. 7: p. 323
    [PMID:17187690]
  5. Popescu SC, et al.
    Differential binding of calmodulin-related proteins to their targets revealed through high-density Arabidopsis protein microarrays.
    Proc. Natl. Acad. Sci. U.S.A., 2007. 104(11): p. 4730-5
    [PMID:17360592]
  6. Andersen SU, et al.
    The conserved cysteine-rich domain of a tesmin/TSO1-like protein binds zinc in vitro and TSO1 is required for both male and female fertility in Arabidopsis thaliana.
    J. Exp. Bot., 2007. 58(13): p. 3657-70
    [PMID:18057042]