PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G18350.1
Common NameAtHB24, HB24, T30D6.14, ZHD6
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family ZF-HD
Protein Properties Length: 262aa    MW: 29950.6 Da    PI: 9.218
Description homeobox protein 24
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G18350.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer100.89.5e-3279133358
  ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58 
                  k+rY+eC+kNhAas Ggh+vDGCgEfm+s geegt+++l CaAC+CHR+FHR+e +
  AT2G18350.1  79 KARYRECQKNHAASSGGHVVDGCGEFMSS-GEEGTVESLLCAACDCHRSFHRKEID 133
                  689*************************9.999********************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257747.0E-4067142IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047706.3E-2980132IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015665.0E-3181132IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.78682131IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466891.33E-17185259IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.9E-28191260IPR009057Homeodomain-like
TIGRFAMsTIGR015659.5E-31198255IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0046872Molecular Functionmetal ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000014anatomyrosette leaf
PO:0000037anatomyshoot apex
PO:0000293anatomyguard cell
PO:0009005anatomyroot
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 262 aa     Download sequence    Send to blast
MEVREKKDEK MEMTRRKSSA LDHHRLPPYT YSQTANKEKP TTKRNGSDPD PDPDLDTNPI  60
SISHAPRSYA RPQTTSPGKA RYRECQKNHA ASSGGHVVDG CGEFMSSGEE GTVESLLCAA  120
CDCHRSFHRK EIDGLFVVNF NSFGHSQRPL GSRHVSPIMM SFGGGGGCAA ESSTEDLNKF  180
HQSFSGYGVD QFHHYQPKKR FRTKFNEEQK EKMMEFAEKI GWRMTKLEDD EVNRFCREIK  240
VKRQVFKVWM HNNKQAAKKK DL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A1e-191992561875ZF-HD homeobox family protein
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.400080.0flower| leaf| root
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO183987130.0
Genevisible265333_at0.0
Expression AtlasAT2G18350-
AtGenExpressAT2G18350-
ATTED-IIAT2G18350-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in seedlings, roots, leaves, stems, flowers and inflorescence. {ECO:0000269|PubMed:16428600}.
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00268DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G18350.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Interaction ? help Back to Top
Source Intact With
BioGRIDAT2G36610, AT5G65410, AT1G26960, AT1G69600
IntActSearch Q9ZPW7
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G18350
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0064390.0AC006439.4 Arabidopsis thaliana chromosome 2 clone T30D6 map mi39, complete sequence.
GenBankCP0026850.0CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_565436.10.0homeobox protein 24
SwissprotQ9ZPW70.0ZHD6_ARATH; Zinc-finger homeodomain protein 6
TrEMBLD7LBB21e-178D7LBB2_ARALL; ATHB24
STRINGAT2G18350.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9116237
MalvidsOGEM65152543
Publications ? help Back to Top
  1. Tan QK,Irish VF
    The Arabidopsis zinc finger-homeodomain genes encode proteins with unique biochemical properties that are coordinately expressed during floral development.
    Plant Physiol., 2006. 140(3): p. 1095-108
    [PMID:16428600]
  2. Hu W,dePamphilis CW,Ma H
    Phylogenetic analysis of the plant-specific zinc finger-homeobox and mini zinc finger gene families.
    J Integr Plant Biol, 2008. 50(8): p. 1031-45
    [PMID:18713354]
  3. Hong SY,Kim OK,Kim SG,Yang MS,Park CM
    Nuclear import and DNA binding of the ZHD5 transcription factor is modulated by a competitive peptide inhibitor in Arabidopsis.
    J. Biol. Chem., 2011. 286(2): p. 1659-68
    [PMID:21059647]