PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G18160.1
Common NameATBZIP2, bZIP2, FTM3, GBF5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family bZIP
Protein Properties Length: 171aa    MW: 19104.1 Da    PI: 4.9402
Description basic leucine-zipper 2
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G18160.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_138.62.3e-123187561
                 CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1  5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklks 61
                 ++ +r+ +NRe+ArrsR RK++ ++ L+  + +L++ N++  + l   ++++ k ++
  AT2G18160.1 31 RKRKRMLSNRESARRSRMRKQKHVDDLTAQINQLSNDNRQILNSLTVTSQLYMKIQA 87
                 57899*********************************8877777666666666555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1702.8E-102274No hitNo description
SMARTSM003385.7E-162791IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.1972992IPR004827Basic-leucine zipper domain
PfamPF001701.4E-93182IPR004827Basic-leucine zipper domain
SuperFamilySSF579597.47E-123182No hitNo description
CDDcd147025.15E-213283No hitNo description
PROSITE patternPS0003603449IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000293anatomyguard cell
PO:0020148anatomyshoot apical meristem
PO:0025195anatomypollen tube cell
PO:0025281anatomypollen
PO:0001016developmental stageL mature pollen stage
PO:0001017developmental stageM germinated pollen stage
Sequence ? help Back to Top
Protein Sequence    Length: 171 aa     Download sequence    Send to blast
MASSSSTYRS SSSSDGGNNN PSDSVVTVDE RKRKRMLSNR ESARRSRMRK QKHVDDLTAQ  60
INQLSNDNRQ ILNSLTVTSQ LYMKIQAENS VLTAQMEELS TRLQSLNEIV DLVQSNGAGF  120
GVDQIDGCGF DDRTVGIDGY YDDMNMMSNV NHWGGSVYTN QPIMANDINM Y
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13051RKRKRMLSNRESARRSRMRKQK
24350RRSRMRKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.234930.0flower| root| seed| silique
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO104434800.0
Genevisible263064_at0.0
Expression AtlasAT2G18160-
AtGenExpressAT2G18160-
ATTED-IIAT2G18160-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed in the shoot meristem during vegetative to reproductive phase transition. {ECO:0000269|PubMed:22319055}.
Functional Description ? help Back to Top
Source Description
TAIREncodes a b-ZIP transcription factor.
UniProtTranscription factor that binds to specific DNA sequences in target gene promoters. {ECO:0000250|UniProtKB:O65683}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00267DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G18160.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Interaction ? help Back to Top
Source Intact With
BioGRIDAT3G54620, AT3G62420, AT4G02640, AT5G24800, AT5G28770
IntActSearch Q9SI15
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G18160
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0072120.0AC007212.7 Arabidopsis thaliana chromosome 2 clone F8D23 map PhyB, complete sequence.
GenBankCP0026850.0CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence.
GenBankBT0007000.0BT000700.1 Arabidopsis thaliana clone RAFL08-13-K01 (R11176) putative bZIP transcription factor (At2g18160) mRNA, complete cds.
GenBankAY1335450.0AY133545.1 Arabidopsis thaliana At2g18160/F8D23.6 mRNA, complete cds.
GenBankAY0372160.0AY037216.1 Arabidopsis thaliana At2g18160/F8D23.6 mRNA, complete cds.
GenBankAK2302440.0AK230244.1 Arabidopsis thaliana mRNA for hypothetical protein, complete cds, clone: RAFL23-13-A15.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_179408.11e-123basic leucine-zipper 2
TrEMBLQ9SI151e-123Q9SI15_ARATH; At2g18160/F8D23.6
STRINGAT2G18160.11e-123(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5511678
MalvidsOGEM50128154
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Jakoby M, et al.
    bZIP transcription factors in Arabidopsis.
    Trends Plant Sci., 2002. 7(3): p. 106-11
    [PMID:11906833]
  3. Ekman DR,Lorenz WW,Przybyla AE,Wolfe NL,Dean JF
    SAGE analysis of transcriptome responses in Arabidopsis roots exposed to 2,4,6-trinitrotoluene.
    Plant Physiol., 2003. 133(3): p. 1397-406
    [PMID:14551330]
  4. Dal Bosco C, et al.
    Inactivation of the chloroplast ATP synthase gamma subunit results in high non-photochemical fluorescence quenching and altered nuclear gene expression in Arabidopsis thaliana.
    J. Biol. Chem., 2004. 279(2): p. 1060-9
    [PMID:14576160]
  5. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  6. Schluepmann H, et al.
    Trehalose mediated growth inhibition of Arabidopsis seedlings is due to trehalose-6-phosphate accumulation.
    Plant Physiol., 2004. 135(2): p. 879-90
    [PMID:15181209]
  7. Gong W, et al.
    Genome-wide ORFeome cloning and analysis of Arabidopsis transcription factor genes.
    Plant Physiol., 2004. 135(2): p. 773-82
    [PMID:15208423]
  8. Deppmann CD, et al.
    Dimerization specificity of all 67 B-ZIP motifs in Arabidopsis thaliana: a comparison to Homo sapiens B-ZIP motifs.
    Nucleic Acids Res., 2004. 32(11): p. 3435-45
    [PMID:15226410]
  9. Scheible WR, et al.
    Genome-wide reprogramming of primary and secondary metabolism, protein synthesis, cellular growth processes, and the regulatory infrastructure of Arabidopsis in response to nitrogen.
    Plant Physiol., 2004. 136(1): p. 2483-99
    [PMID:15375205]
  10. de Diego JG,David Rodr
    cDNA-AFLP analysis of seed germination in Arabidopsis thaliana identifies transposons and new genomic sequences.
    J. Plant Physiol., 2006. 163(4): p. 452-62
    [PMID:16455359]
  11. Pischke MS,Huttlin EL,Hegeman AD,Sussman MR
    A transcriptome-based characterization of habituation in plant tissue culture.
    Plant Physiol., 2006. 140(4): p. 1255-78
    [PMID:16489130]
  12. Ehlert A, et al.
    Two-hybrid protein-protein interaction analysis in Arabidopsis protoplasts: establishment of a heterodimerization map of group C and group S bZIP transcription factors.
    Plant J., 2006. 46(5): p. 890-900
    [PMID:16709202]
  13. Deppmann CD,Alvania RS,Taparowsky EJ
    Cross-species annotation of basic leucine zipper factor interactions: Insight into the evolution of closed interaction networks.
    Mol. Biol. Evol., 2006. 23(8): p. 1480-92
    [PMID:16731568]
  14. Weltmeier F, et al.
    Combinatorial control of Arabidopsis proline dehydrogenase transcription by specific heterodimerisation of bZIP transcription factors.
    EMBO J., 2006. 25(13): p. 3133-43
    [PMID:16810321]
  15. Cheng C, et al.
    An early response regulatory cluster induced by low temperature and hydrogen peroxide in seedlings of chilling-tolerant japonica rice.
    BMC Genomics, 2007. 8: p. 175
    [PMID:17577400]
  16. Hayden CA,Jorgensen RA
    Identification of novel conserved peptide uORF homology groups in Arabidopsis and rice reveals ancient eukaryotic origin of select groups and preferential association with transcription factor-encoding genes.
    BMC Biol., 2007. 5: p. 32
    [PMID:17663791]
  17. Usadel B, et al.
    Global transcript levels respond to small changes of the carbon status during progressive exhaustion of carbohydrates in Arabidopsis rosettes.
    Plant Physiol., 2008. 146(4): p. 1834-61
    [PMID:18305208]
  18. Ascencio-Ib
    Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection.
    Plant Physiol., 2008. 148(1): p. 436-54
    [PMID:18650403]
  19. Wang Y, et al.
    Transcriptome analyses show changes in gene expression to accompany pollen germination and tube growth in Arabidopsis.
    Plant Physiol., 2008. 148(3): p. 1201-11
    [PMID:18775970]
  20. Torti S, et al.
    Analysis of the Arabidopsis shoot meristem transcriptome during floral transition identifies distinct regulatory patterns and a leucine-rich repeat protein that promotes flowering.
    Plant Cell, 2012. 24(2): p. 444-62
    [PMID:22319055]
  21. Efroni I, et al.
    Regulation of leaf maturation by chromatin-mediated modulation of cytokinin responses.
    Dev. Cell, 2013. 24(4): p. 438-45
    [PMID:23449474]