PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G18060.1
Common NameANAC037, NAC037, T27K22.7, VND1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NAC
Protein Properties Length: 365aa    MW: 42476.7 Da    PI: 5.2318
Description vascular related NAC-domain protein 1
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G18060.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM177.34e-5591381129
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk...kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                  +ppGfrFhPtdeelv +yL+kk++++k++l +vi+++d+y++ePwdL++     ++e++ewyfFs++dkky+tg+r+nrat +g+Wkatg+dk+v++ 
  AT2G18060.1   9 VPPGFRFHPTDEELVGYYLRKKIASQKIDL-DVIRDIDLYRIEPWDLQEqcrIGYEEQNEWYFFSHKDKKYPTGTRTNRATMAGFWKATGRDKAVYD- 104
                  69****************************.9***************953432233667**************************************. PP

          NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrle 129
                  k++l+g++ktLvfykgrap+g+k+dW+mheyrle
  AT2G18060.1 105 KTKLIGMRKTLVFYKGRAPNGKKSDWIMHEYRLE 138
                  999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.7E-603158IPR003441NAC domain
PROSITE profilePS5100559.2799158IPR003441NAC domain
PfamPF023659.7E-2910137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007275Biological Processmulticellular organism development
GO:0010200Biological Processresponse to chitin
GO:0048759Biological Processxylem vessel member cell differentiation
GO:0071555Biological Processcell wall organization
GO:1901348Biological Processpositive regulation of secondary cell wall biogenesis
GO:1990110Biological Processcallus formation
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0003011anatomyroot vascular system
PO:0009005anatomyroot
PO:0009046anatomyflower
PO:0020100anatomyhypocotyl
PO:0025275anatomyprocambium
PO:0007611developmental stagepetal differentiation and expansion stage
Sequence ? help Back to Top
Protein Sequence    Length: 365 aa     Download sequence    Send to blast
MEPMESCSVP PGFRFHPTDE ELVGYYLRKK IASQKIDLDV IRDIDLYRIE PWDLQEQCRI  60
GYEEQNEWYF FSHKDKKYPT GTRTNRATMA GFWKATGRDK AVYDKTKLIG MRKTLVFYKG  120
RAPNGKKSDW IMHEYRLESD ENAPPQEEGW VVCRAFKKRA TGQAKNTETW SSSYFYDEVA  180
PNGVNSVMDP IDYISKQQHN IFGKGLMCKQ ELEGMVDGIN YIQSNQFIQL PQLQSPSLPL  240
MKRPSSSMSI TSMDNNYNYK LPLADEESFE SFIRGEDRRK KKKQVMMTGN WRELDKFVAS  300
QLMSQEDNGT SSFAGHHIVN EDKNNNDVEM DSSMFLSERE EENRFVSEFL STNSDYDIGI  360
CVFDN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B5e-51216310170NAC domain-containing protein 19
4dul_A5e-51216310170NAC domain-containing protein 19
1ut7_B5e-51216310170NO APICAL MERISTEM PROTEIN
1ut7_A5e-51216310170NO APICAL MERISTEM PROTEIN
1ut4_B5e-51216310170NO APICAL MERISTEM PROTEIN
1ut4_A5e-51216310170NO APICAL MERISTEM PROTEIN
3swp_D5e-51216313173NAC domain-containing protein 19
3swp_C5e-51216313173NAC domain-containing protein 19
3swp_B5e-51216313173NAC domain-containing protein 19
3swp_A5e-51216313173NAC domain-containing protein 19
3swm_D5e-51216313173NAC domain-containing protein 19
3swm_C5e-51216313173NAC domain-containing protein 19
3swm_B5e-51216313173NAC domain-containing protein 19
3swm_A5e-51216313173NAC domain-containing protein 19
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1276282DRRKKKK
2277282RRKKKK
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO183986070.0
Genevisible265813_at0.0
Expression AtlasAT2G18060-
AtGenExpressAT2G18060-
ATTED-IIAT2G18060-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Up-regulated during xylem vessel element formation. Expressed preferentially in procambial cells adjacent to root meristem. {ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:25148240}.
UniprotTISSUE SPECIFICITY: Expressed in root metaxylem pole and in shoot pre-procambium and procambium (PubMed:18445131). Present in root developing xylems (PubMed:16103214). Specifically expressed in vessels but not in interfascicular fibers in stems (PubMed:25148240). {ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:18445131, ECO:0000269|PubMed:25148240}.
Functional Description ? help Back to Top
Source Description
TAIREncodes a NAC-domain transcription factor. Expressed in the vascular tissue.
UniProtTranscription activator that binds to the secondary wall NAC binding element (SNBE), 5'-(T/A)NN(C/T)(T/C/G)TNNNNNNNA(A/C)GN(A/C/T)(A/T)-3', in the promoter of target genes (By similarity). Involved in xylem formation by promoting the expression of secondary wall-associated transcription factors and of genes involved in secondary wall biosynthesis and programmed cell death, genes driven by the secondary wall NAC binding element (SNBE). Triggers thickening of secondary walls (PubMed:25148240). {ECO:0000250|UniProtKB:Q9LVA1, ECO:0000269|PubMed:25148240}.
Function -- GeneRIF ? help Back to Top
  1. transactivation analysis revealed that VND1 to VND5 could activate expression of the GUS reporter gene driven by the secondary wall NAC binding element (SNBE).
    [PMID: 25148240]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00266DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G18060.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by chitin (e.g. chitooctaose) (PubMed:17722694). Accumulates in plants exposed to callus induction medium (CIM) (PubMed:17581762). {ECO:0000269|PubMed:17581762, ECO:0000269|PubMed:17722694}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Interaction ? help Back to Top
Source Intact With
BioGRIDAT5G13180
IntActSearch Q9SL41
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G18060
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0062010.0AC006201.4 Arabidopsis thaliana chromosome 2 clone T27K22 map c245, complete sequence.
GenBankCP0026850.0CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_179397.10.0vascular related NAC-domain protein 1
SwissprotQ9SL410.0NAC37_ARATH; NAC domain-containing protein 37
TrEMBLD7LAF10.0D7LAF1_ARALL; Predicted protein
STRINGAT2G18060.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1715800
MalvidsOGEM36862661
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Ooka H, et al.
    Comprehensive analysis of NAC family genes in Oryza sativa and Arabidopsis thaliana.
    DNA Res., 2003. 10(6): p. 239-47
    [PMID:15029955]
  3. Kubo M, et al.
    Transcription switches for protoxylem and metaxylem vessel formation.
    Genes Dev., 2005. 19(16): p. 1855-60
    [PMID:16103214]
  4. Andersson-Gunner
    Biosynthesis of cellulose-enriched tension wood in Populus: global analysis of transcripts and metabolites identifies biochemical and developmental regulators in secondary wall biosynthesis.
    Plant J., 2006. 45(2): p. 144-65
    [PMID:16367961]
  5. Fleury D, et al.
    The Arabidopsis thaliana homolog of yeast BRE1 has a function in cell cycle regulation during early leaf and root growth.
    Plant Cell, 2007. 19(2): p. 417-32
    [PMID:17329565]
  6. Ko JH,Yang SH,Park AH,Lerouxel O,Han KH
    ANAC012, a member of the plant-specific NAC transcription factor family, negatively regulates xylary fiber development in Arabidopsis thaliana.
    Plant J., 2007. 50(6): p. 1035-48
    [PMID:17565617]
  7. Che P,Lall S,Howell SH
    Developmental steps in acquiring competence for shoot development in Arabidopsis tissue culture.
    Planta, 2007. 226(5): p. 1183-94
    [PMID:17581762]
  8. Libault M,Wan J,Czechowski T,Udvardi M,Stacey G
    Identification of 118 Arabidopsis transcription factor and 30 ubiquitin-ligase genes responding to chitin, a plant-defense elicitor.
    Mol. Plant Microbe Interact., 2007. 20(8): p. 900-11
    [PMID:17722694]
  9. Yamaguchi M,Kubo M,Fukuda H,Demura T
    Vascular-related NAC-DOMAIN7 is involved in the differentiation of all types of xylem vessels in Arabidopsis roots and shoots.
    Plant J., 2008. 55(4): p. 652-64
    [PMID:18445131]
  10. Yamaguchi M, et al.
    VND-INTERACTING2, a NAC domain transcription factor, negatively regulates xylem vessel formation in Arabidopsis.
    Plant Cell, 2010. 22(4): p. 1249-63
    [PMID:20388856]
  11. Brady SM, et al.
    A stele-enriched gene regulatory network in the Arabidopsis root.
    Mol. Syst. Biol., 2011. 7: p. 459
    [PMID:21245844]
  12. Zhou J,Zhong R,Ye ZH
    Arabidopsis NAC domain proteins, VND1 to VND5, are transcriptional regulators of secondary wall biosynthesis in vessels.
    PLoS ONE, 2014. 9(8): p. e105726
    [PMID:25148240]