PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G17150.1
Common NameF6P23.15, NLP1, T23A1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family Nin-like
Protein Properties Length: 909aa    MW: 100886 Da    PI: 4.8316
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G17150.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK91.28e-29606656252
       RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                  ek+i le+l++yF++++kdAAk++gvc+T+LKriCRq+GI+RWP+Rkik++
  AT2G17150.1 606 EKTIGLEVLRQYFAGSLKDAAKSIGVCPTTLKRICRQHGIMRWPSRKIKKV 656
                  799**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.245595676IPR003035RWP-RK domain
PfamPF020422.6E-25609656IPR003035RWP-RK domain
SuperFamilySSF542774.25E-23801896No hitNo description
Gene3DG3DSA:3.10.20.2406.5E-23810891No hitNo description
PROSITE profilePS5174523.819811894IPR000270PB1 domain
SMARTSM006665.8E-27811894IPR000270PB1 domain
PfamPF005643.2E-15812893IPR000270PB1 domain
CDDcd064077.79E-41812893No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 909 aa     Download sequence    Send to blast
MEDDGGSDGG EGNGGFSPNS SFGAFADTAM DLDFMDELLF DGCWLETTDS KSLKQTEQSP  60
SASTAMNDNS PFLCFGENPS QDNFSNEETE RMFPQAEKFL LEEAEVGKSW WIAPSASEGP  120
SSSVKERLLQ AISGLNEAVQ DKDFLVQIWV PIQQEGKSFL TTWAQPHLFN QEYSSLAEYR  180
HVSETYNFPA DEGMKDFVGL PGRVFLQKFP EWTPDVRFFR RDEYPRIKEA QKCDVRGSLA  240
LPVFERGSGT CLGVVEIVTT TQKMNYRQEL EKMCKALEAV DLRSSSNLNT PSSEFLQVYS  300
DFYCAALPEI KDFLATICRS YDFPLALSWA PCARQGKVGS RHSDENFSEC VSTIDSACSV  360
PDEQSKSFWE ACSEHHLLQG EGIVGKAFEA TKLFFVPEVA TFSKTNYPLA HHAKISGLHA  420
ALAVPLKSKS GLVEFVLEFF FPKACLDTEA QQEMLKSLCV TLQQDFRSSN LFIKDLELEV  480
VLPVRETMLF SENLLCGAET VESLTEIQMQ ESSWIAHMIK ANEKGKDVSL SWEYQKEDPK  540
ELSSGRENSQ LDPVPNNVPL EAEQLQQAST PGLRVDIGPS TESASTGGGN MLSSRRPGEK  600
KRAKTEKTIG LEVLRQYFAG SLKDAAKSIG VCPTTLKRIC RQHGIMRWPS RKIKKVGHSL  660
KKLQLVMDSV QGAQGSIQLD SFYTSFPELN SPNMSSNGPS LKSNEQPSHL NAQTDNGIMA  720
EENPRSPSSS CSKSSGSSNN NENTGNILVA EDADAVLKRA HSEAQLHNVN QEETKCLART  780
QSHKTFKEPL VLDNSSPLTG SSNTSLRARG AIKVKATFGE ARIRFTLLPS WGFAELKQEI  840
ARRFNIDDIS WFDLKYLDDD KEWVLLTCEA DLVECIDIYR LTQTHTIKIS LNEASQVKLS  900
GSFGNTGLS
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.401850.0flower
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible263573_at0.0
Expression AtlasAT2G17150-
AtGenExpressAT2G17150-
ATTED-IIAT2G17150-
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G17150.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
BioGRIDAT1G64530
IntActSearch Q8H111
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G17150
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0909430.0AY090943.1 Arabidopsis thaliana At2g17150 mRNA sequence.
GenBankBT0009110.0BT000911.1 Arabidopsis thaliana clone C105242 unknown protein (At2g17150) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001324424.10.0Plant regulator RWP-RK family protein
RefseqNP_179306.20.0Plant regulator RWP-RK family protein
SwissprotQ8H1110.0NLP1_ARATH; Protein NLP1
TrEMBLD7L8S40.0D7L8S4_ARALL; Predicted protein
STRINGAT2G17150.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19982777
Representative plantOGRP2991697
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  3. Schauser L,Wieloch W,Stougaard J
    Evolution of NIN-like proteins in Arabidopsis, rice, and Lotus japonicus.
    J. Mol. Evol., 2005. 60(2): p. 229-37
    [PMID:15785851]
  4. Elrouby N,Coupland G
    Proteome-wide screens for small ubiquitin-like modifier (SUMO) substrates identify Arabidopsis proteins implicated in diverse biological processes.
    Proc. Natl. Acad. Sci. U.S.A., 2010. 107(40): p. 17415-20
    [PMID:20855607]
  5. Arabidopsis Interactome Mapping Consortium
    Evidence for network evolution in an Arabidopsis interactome map.
    Science, 2011. 333(6042): p. 601-7
    [PMID:21798944]
  6. Suzuki W,Konishi M,Yanagisawa S
    The evolutionary events necessary for the emergence of symbiotic nitrogen fixation in legumes may involve a loss of nitrate responsiveness of the NIN transcription factor.
    Plant Signal Behav, 2014.
    [PMID:24270631]