PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G17040.1
Common Nameanac036, NAC036
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NAC
Protein Properties Length: 276aa    MW: 31817.5 Da    PI: 9.2526
Description NAC domain containing protein 36
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G17040.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM150.57.9e-4781343128
          NAM   3 pGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk..kge 98 
                  pGfrFhPt+eel+++yLk+ v gk+ ++ evi  ++iy+++PwdLp   + +e+ewyfF++r++k+ +g r++r+t++gyWkatg+d++++s    ++
  AT2G17040.1   8 PGFRFHPTEEELLDFYLKNMVYGKRSSV-EVIGFLNIYRHDPWDLPGLSRIGEREWYFFVPRERKHGNGGRPSRTTEKGYWKATGSDRKIISLsePKR 104
                  9************************999.99***************7777899*************************************98755777 PP

          NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                  ++glkktLvfy+grap g+ktdWvm+e+r+
  AT2G17040.1 105 VIGLKKTLVFYRGRAPGGSKTDWVMNEFRM 134
                  8***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100553.8596152IPR003441NAC domain
SuperFamilySSF1019416.15E-567152IPR003441NAC domain
PfamPF023651.2E-248134IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009965Biological Processleaf morphogenesis
GO:0010200Biological Processresponse to chitin
GO:0045792Biological Processnegative regulation of cell size
GO:0048281Biological Processinflorescence morphogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000014anatomyrosette leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0001054developmental stagevascular leaf senescent stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 276 aa     Download sequence    Send to blast
MGKDIELPGF RFHPTEEELL DFYLKNMVYG KRSSVEVIGF LNIYRHDPWD LPGLSRIGER  60
EWYFFVPRER KHGNGGRPSR TTEKGYWKAT GSDRKIISLS EPKRVIGLKK TLVFYRGRAP  120
GGSKTDWVMN EFRMPDNCSL PKDVVLCKIY RKATSLKVLE QRAEMEAKMN QTCPNSPLSS  180
SETISFVGKE ENMMTSFRAP QVIAMEEANK IQMHQENAKT EEKQREAETK EPSSSLKLPF  240
GSLPELQLPK PGVEWDQLLS ISPWLQNLTP IVNIYW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A7e-45815519168NO APICAL MERISTEM PROTEIN
1ut4_B7e-45815519168NO APICAL MERISTEM PROTEIN
1ut7_A7e-45815519168NO APICAL MERISTEM PROTEIN
1ut7_B7e-45815519168NO APICAL MERISTEM PROTEIN
3swm_A6e-45815522171NAC domain-containing protein 19
3swm_B6e-45815522171NAC domain-containing protein 19
3swm_C6e-45815522171NAC domain-containing protein 19
3swm_D6e-45815522171NAC domain-containing protein 19
3swp_A6e-45815522171NAC domain-containing protein 19
3swp_B6e-45815522171NAC domain-containing protein 19
3swp_C6e-45815522171NAC domain-containing protein 19
3swp_D6e-45815522171NAC domain-containing protein 19
4dul_A7e-45815519168NAC domain-containing protein 19
4dul_B7e-45815519168NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.287100.0leaf
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1453600210.0
Genevisible263584_at0.0
Expression AtlasAT2G17040-
AtGenExpressAT2G17040-
ATTED-IIAT2G17040-
Functional Description ? help Back to Top
Source Description
TAIRMember of the NAC transcription factor family and more specifically, the ONAC022 subfamily. Involved in leaf and inflorescence stem morphogenesis.
Function -- GeneRIF ? help Back to Top
  1. Semidwarf phenotype induced by overexpression of the ANAC036 gene
    [PMID: 19962211]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G17040.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G17040
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3618040.0AF361804.1 Arabidopsis thaliana At2g17040 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_565404.20.0NAC transcription factor family protein NAC036
TrEMBLF4IME80.0F4IME8_ARATH; NAC domain containing protein 36
STRINGAT2G17040.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1715800
MalvidsOGEM38992860
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Ooka H, et al.
    Comprehensive analysis of NAC family genes in Oryza sativa and Arabidopsis thaliana.
    DNA Res., 2003. 10(6): p. 239-47
    [PMID:15029955]
  3. Goda H, et al.
    Comprehensive comparison of auxin-regulated and brassinosteroid-regulated genes in Arabidopsis.
    Plant Physiol., 2004. 134(4): p. 1555-73
    [PMID:15047898]
  4. Ko JH,Han KH,Park S,Yang J
    Plant body weight-induced secondary growth in Arabidopsis and its transcription phenotype revealed by whole-transcriptome profiling.
    Plant Physiol., 2004. 135(2): p. 1069-83
    [PMID:15194820]
  5. Hampton CR, et al.
    Cesium toxicity in Arabidopsis.
    Plant Physiol., 2004. 136(3): p. 3824-37
    [PMID:15489280]
  6. Nagata T,Yamada H,Du Z,Todoriki S,Kikuchi S
    Microarray analysis of genes that respond to gamma-irradiation in Arabidopsis.
    J. Agric. Food Chem., 2005. 53(4): p. 1022-30
    [PMID:15713015]
  7. Xin Z,Zhao Y,Zheng ZL
    Transcriptome analysis reveals specific modulation of abscisic acid signaling by ROP10 small GTPase in Arabidopsis.
    Plant Physiol., 2005. 139(3): p. 1350-65
    [PMID:16258012]
  8. Mosher RA,Durrant WE,Wang D,Song J,Dong X
    A comprehensive structure-function analysis of Arabidopsis SNI1 defines essential regions and transcriptional repressor activity.
    Plant Cell, 2006. 18(7): p. 1750-65
    [PMID:16766691]
  9. Kleine T,Kindgren P,Benedict C,Hendrickson L,Strand A
    Genome-wide gene expression analysis reveals a critical role for CRYPTOCHROME1 in the response of Arabidopsis to high irradiance.
    Plant Physiol., 2007. 144(3): p. 1391-406
    [PMID:17478635]
  10. Libault M,Wan J,Czechowski T,Udvardi M,Stacey G
    Identification of 118 Arabidopsis transcription factor and 30 ubiquitin-ligase genes responding to chitin, a plant-defense elicitor.
    Mol. Plant Microbe Interact., 2007. 20(8): p. 900-11
    [PMID:17722694]
  11. Meier S, et al.
    Co-expression and promoter content analyses assign a role in biotic and abiotic stress responses to plant natriuretic peptides.
    BMC Plant Biol., 2008. 8: p. 24
    [PMID:18307823]
  12. Ascencio-Ib
    Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection.
    Plant Physiol., 2008. 148(1): p. 436-54
    [PMID:18650403]
  13. Kato H,Motomura T,Komeda Y,Saito T,Kato A
    Overexpression of the NAC transcription factor family gene ANAC036 results in a dwarf phenotype in Arabidopsis thaliana.
    J. Plant Physiol., 2010. 167(7): p. 571-7
    [PMID:19962211]