PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G16770.1
Common NamebZIP23
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family bZIP
Protein Properties Length: 249aa    MW: 27299.7 Da    PI: 6.4986
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G16770.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_129.71.4e-0979122851
                  HCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   8 rrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkelee 51 
                  +r   NReA r++R++Kka+ + Le++v  L+a N +L k+l+ 
  AT2G16770.1  79 KRPLGNREAVRKYREKKKAKAASLEDEVMRLKAVNNQLLKRLQG 122
                  77788**********************************99974 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1703.8E-1567140No hitNo description
SMARTSM003381.6E-1072139IPR004827Basic-leucine zipper domain
PfamPF077161.6E-1573129IPR004827Basic-leucine zipper domain
PROSITE profilePS502178.55474121IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.06E-777121No hitNo description
CDDcd146868.79E-1278130No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0071294Biological Processcellular response to zinc ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000293anatomyguard cell
Sequence ? help Back to Top
Protein Sequence    Length: 249 aa     Download sequence    Send to blast
MDDGELEFSN SNMGGELPSC SMDSFFDELL RDSHACTHTH TCNPPGPENT HTHTCLHVHT  60
KILPDKVSTD DTSESSGKKR PLGNREAVRK YREKKKAKAA SLEDEVMRLK AVNNQLLKRL  120
QGQAALEAEV TRLKCLLVDI RGRIDGEIGA FPYQKPAVTN VPYSYMMHPC NMQCDVDNLY  180
CLQNGNNGEG ASMNEQGLNG CEFDQLECLA NQNLAGKEIP VCSNGIGTFT VNGSGVNKRK  240
GEPRAAKAV
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.402380.0flower| root
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasAT2G16770
AtGenExpressAT2G16770
Functional Description ? help Back to Top
Source Description
TAIRBasic-region leucine zipper (bZIP23) transcription factor involved in the adaptation to zinc deficiency. Binds ZDRE motifs.
UniProtTranscription factor involved in the response to zinc ion deficiency. Binds to the consensus sequence 5'-[AG]TGTCGACA[CT]-3' also called zinc deficiency response element (ZDRE). The ZDRE sequence is conserved in the plant kingdom and present in the promoters of genes that constitute the primary response to zinc deficiency, comprising additional ZIP metal transporter genes (PubMed:20479230, PubMed:26306426). Required for zinc accumulation in roots. Mediates the expression of the zinc transporter ZIP12 during growth in zinc-deficient conditions. ZIP12 transporter is involved in zinc uptake in roots (PubMed:26306426). {ECO:0000269|PubMed:20479230, ECO:0000269|PubMed:26306426}.
Function -- GeneRIF ? help Back to Top
  1. Studies indicate that zinc deficiency leads to the activation of bZIP9 and bZIP23.
    [PMID: 23851954]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G16770.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by zinc deficiency. {ECO:0000269|PubMed:20479230}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
IntActSearch Q8GTS2
Phenotype -- Disruption Phenotype ? help Back to Top
Source Description
UniProtDISRUPTION PHENOTYPE: No visible phenotype under normal growth conditions (PubMed:20479230, PubMed:26306426). Mutant seedlings grown under normal conditions accumulate reduced levels of zinc in roots. Mutant seedlings grown in zinc-depleted medium have reduced root length (PubMed:26306426). {ECO:0000269|PubMed:20479230, ECO:0000269|PubMed:26306426}.
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G16770
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0290220.0BT029022.1 Arabidopsis thaliana At2g16770 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_179268.20.0transcription factor bZIP23
SwissprotQ8GTS20.0BZP23_ARATH; Basic leucine zipper 23
TrEMBLD7L8711e-179D7L871_ARALL; DNA binding protein
STRINGAT2G16770.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP19701536
MalvidsOGEM20362879
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Jakoby M, et al.
    bZIP transcription factors in Arabidopsis.
    Trends Plant Sci., 2002. 7(3): p. 106-11
    [PMID:11906833]
  3. Seki M, et al.
    Functional annotation of a full-length Arabidopsis cDNA collection.
    Science, 2002. 296(5565): p. 141-5
    [PMID:11910074]
  4. Satoh R,Fujita Y,Nakashima K,Shinozaki K,Yamaguchi-Shinozaki K
    A novel subgroup of bZIP proteins functions as transcriptional activators in hypoosmolarity-responsive expression of the ProDH gene in Arabidopsis.
    Plant Cell Physiol., 2004. 45(3): p. 309-17
    [PMID:15047879]
  5. Deppmann CD, et al.
    Dimerization specificity of all 67 B-ZIP motifs in Arabidopsis thaliana: a comparison to Homo sapiens B-ZIP motifs.
    Nucleic Acids Res., 2004. 32(11): p. 3435-45
    [PMID:15226410]
  6. Deppmann CD,Alvania RS,Taparowsky EJ
    Cross-species annotation of basic leucine zipper factor interactions: Insight into the evolution of closed interaction networks.
    Mol. Biol. Evol., 2006. 23(8): p. 1480-92
    [PMID:16731568]
  7. Jaspers P, et al.
    Unequally redundant RCD1 and SRO1 mediate stress and developmental responses and interact with transcription factors.
    Plant J., 2009. 60(2): p. 268-79
    [PMID:19548978]
  8. Rehrauer H, et al.
    AGRONOMICS1: a new resource for Arabidopsis transcriptome profiling.
    Plant Physiol., 2010. 152(2): p. 487-99
    [PMID:20032078]
  9. Assun
    Arabidopsis thaliana transcription factors bZIP19 and bZIP23 regulate the adaptation to zinc deficiency.
    Proc. Natl. Acad. Sci. U.S.A., 2010. 107(22): p. 10296-301
    [PMID:20479230]
  10. Causier B,Ashworth M,Guo W,Davies B
    The TOPLESS interactome: a framework for gene repression in Arabidopsis.
    Plant Physiol., 2012. 158(1): p. 423-38
    [PMID:22065421]
  11. Assun
    Model of how plants sense zinc deficiency.
    Metallomics, 2013. 5(9): p. 1110-6
    [PMID:23851954]
  12. Inaba S, et al.
    Identification of putative target genes of bZIP19, a transcription factor essential for Arabidopsis adaptation to Zn deficiency in roots.
    Plant J., 2015. 84(2): p. 323-34
    [PMID:26306426]