PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G16400.1
Common NameBLH7, F16F14.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family TALE
Protein Properties Length: 482aa    MW: 54243.5 Da    PI: 7.1294
Description BEL1-like homeodomain 7
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G16400.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox26.21.4e-083053421954
                  HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
     Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                  Fe   ++yp+ +++  LA+++gL+  qV++WF N R +
  AT2G16400.1 305 FEHflHPYPKDSDKIMLARQTGLSRGQVSNWFINARVR 342
                  554458******************************88 PP

2BELL126.69.2e-41167238172
         BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                  erqelq+k +kLls+l+eVd++Ykqy++q+q+v+ssF+++ag+g+akpYt+lAl++iSrhFrcL+dai++qi
  AT2G16400.1 167 ERQELQSKLSKLLSILDEVDRNYKQYYHQMQIVVSSFDVIAGCGAAKPYTALALQTISRHFRCLRDAISGQI 238
                  79*********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005748.9E-72109236IPR006563POX domain
PfamPF075269.6E-46115235IPR006563POX domain
PROSITE profilePS5007111.564283346IPR001356Homeobox domain
CDDcd000868.89E-11286347No hitNo description
SMARTSM003895.9E-9286350IPR001356Homeobox domain
SuperFamilySSF466895.99E-17287353IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.8E-27289352IPR009057Homeodomain-like
PfamPF059209.0E-18303342IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 482 aa     Download sequence    Send to blast
MATYYKTGSS EIYSRPEFVP GNAMNYTNSF TETFPRDSTN NVSPSKEIQV LSSLGGVSQM  60
VEIQDSGSWR DQEDNDRNRF PVMRRLGLSS QIETSRGNNN NEYATQVVSG FTRTIHNSKY  120
LKAAQELLDE TVNVKKALKQ FQPEGDKINE VKEKNLQTNT AEIPQAERQE LQSKLSKLLS  180
ILDEVDRNYK QYYHQMQIVV SSFDVIAGCG AAKPYTALAL QTISRHFRCL RDAISGQILV  240
IRKSLGGEQD GSDGRGVGIS RLRNVDQQVR QQRALQRLGV MQPHTWRPQR GLPDSSVLVL  300
RAWLFEHFLH PYPKDSDKIM LARQTGLSRG QVSNWFINAR VRLWKPMVEE MYKEEFTDAL  360
QENDPNQSSE NTPEITEIQE LQTESSSNNG HVPGVASSSM RQNTVAHGGD RFMMVTDMTR  420
NGNGGMSLTL GIQNSDARGD VPMSGGIDNY KNTISGTDLQ YLNSRNHQHQ IGSSQLLHDF  480
VA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A8e-15292350563Homeobox protein Meis2
3k2a_B8e-15292350563Homeobox protein Meis2
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.143050.0flower| inflorescence| silique
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1453600020.0
Genevisible263557_at0.0
Expression AtlasAT2G16400-
AtGenExpressAT2G16400-
ATTED-IIAT2G16400-
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G16400.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
BioGRIDAT4G08150, AT4G32040, AT5G25220, AT1G23380, AT1G62990, AT1G75410
IntActSearch Q9SIW1
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G16400
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0006090.0BT000609.1 Arabidopsis thaliana putative homeodomain transcription factor (At2g16400/F16F14.10) mRNA, complete cds.
GenBankAY0567960.0AY056796.1 Arabidopsis thaliana At2g16400/F16F14.10 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_179233.10.0BEL1-like homeodomain 7
SwissprotQ9SIW10.0BLH7_ARATH; BEL1-like homeodomain protein 7
TrEMBLD7L1V50.0D7L1V5_ARALL; Putative uncharacterized protein
STRINGAT2G16400.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP13316172
MalvidsOGEM28692563
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  3. Bhatt AM,Etchells JP,Canales C,Lagodienko A,Dickinson H
    VAAMANA--a BEL1-like homeodomain protein, interacts with KNOX proteins BP and STM and regulates inflorescence stem growth in Arabidopsis.
    Gene, 2004. 328: p. 103-11
    [PMID:15019989]
  4. Smith HM,Campbell BC,Hake S
    Competence to respond to floral inductive signals requires the homeobox genes PENNYWISE and POUND-FOOLISH.
    Curr. Biol., 2004. 14(9): p. 812-7
    [PMID:15120075]
  5. Hackbusch J,Richter K,Müller J,Salamini F,Uhrig JF
    A central role of Arabidopsis thaliana ovate family proteins in networking and subcellular localization of 3-aa loop extension homeodomain proteins.
    Proc. Natl. Acad. Sci. U.S.A., 2005. 102(13): p. 4908-12
    [PMID:15781858]
  6. Andersson-Gunner
    Biosynthesis of cellulose-enriched tension wood in Populus: global analysis of transcripts and metabolites identifies biochemical and developmental regulators in secondary wall biosynthesis.
    Plant J., 2006. 45(2): p. 144-65
    [PMID:16367961]
  7. Arabidopsis Interactome Mapping Consortium
    Evidence for network evolution in an Arabidopsis interactome map.
    Science, 2011. 333(6042): p. 601-7
    [PMID:21798944]