PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G14210.1
Common NameAGL44, ANR1, F15N24.5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MIKC_MADS
Protein Properties Length: 234aa    MW: 26802.8 Da    PI: 10.3064
Description AGAMOUS-like 44
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G14210.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF89.51.8e-281059251
                 ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
       SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                 ri+n++ rqvtfskRr g+lKKA+ELS+LCdaev viifsstgkly+y+s
  AT2G14210.1 10 RIDNSTSRQVTFSKRRSGLLKKAKELSILCDAEVGVIIFSSTGKLYDYAS 59
                 8***********************************************86 PP

2K-box82.78.2e-2882170997
        K-box   9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkk 97 
                  +++++ + +q+e+a L+++++ Lq+ +R+l+Ge+L+ ++ ++Lq+Le+qL +slk +R kK++l++++i+el +k + +q+en++L++ 
  AT2G14210.1  82 NHASEIKFWQREVASLQQQLQYLQECHRKLVGEELSGMNANDLQNLEDQLVTSLKGVRLKKDQLMTNEIRELNRKGQIIQKENHELQNI 170
                  688999********************************************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004328.0E-40160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.665161IPR002100Transcription factor, MADS-box
CDDcd002651.90E-41279No hitNo description
SuperFamilySSF554552.22E-32292IPR002100Transcription factor, MADS-box
PRINTSPR004041.8E-28323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003191.9E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004041.8E-282338IPR002100Transcription factor, MADS-box
PRINTSPR004041.8E-283859IPR002100Transcription factor, MADS-box
PfamPF014865.8E-2483169IPR002487Transcription factor, K-box
PROSITE profilePS5129714.13587177IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007584Biological Processresponse to nutrient
GO:0048527Biological Processlateral root development
GO:0071249Biological Processcellular response to nitrate
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008134Molecular Functiontranscription factor binding
GO:0046983Molecular Functionprotein dimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0009005anatomyroot
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009046anatomyflower
PO:0025022anatomycollective leaf structure
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007611developmental stagepetal differentiation and expansion stage
Sequence ? help Back to Top
Protein Sequence    Length: 234 aa     Download sequence    Send to blast
MGRGKIVIRR IDNSTSRQVT FSKRRSGLLK KAKELSILCD AEVGVIIFSS TGKLYDYASN  60
SSMKTIIERY NRVKEEQHQL LNHASEIKFW QREVASLQQQ LQYLQECHRK LVGEELSGMN  120
ANDLQNLEDQ LVTSLKGVRL KKDQLMTNEI RELNRKGQII QKENHELQNI VDIMRKENIK  180
LQKKVHGRTN AIEGNSSVDP ISNGTTTYAP PQLQLIQLQP APREKSIRLG LQLS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A2e-19175174MEF2C
5f28_B2e-19175174MEF2C
5f28_C2e-19175174MEF2C
5f28_D2e-19175174MEF2C
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.1260.0leaf| root
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO29593190.0
Genevisible263295_at0.0
Expression AtlasAT2G14210-
AtGenExpressAT2G14210-
ATTED-IIAT2G14210-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Specifically expressed in roots, mostly in lateral roots (LR) primordia, young emerging LRs, apex and base of LRs, apex of the primary root, and in the stele. Barely detectable in shoots. {ECO:0000269|PubMed:12837945, ECO:0000269|PubMed:16021502, ECO:0000269|PubMed:17148611, ECO:0000269|PubMed:9430595}.
Functional Description ? help Back to Top
Source Description
TAIRMADS box gene, transcription factor
UniProtProbable transcription factor. Required for root plasticity in response to nitrate, NO(3)(-). Promotes lateral root growth in a NRT1.1-dependent manner. {ECO:0000269|PubMed:15667327, ECO:0000269|PubMed:17148611, ECO:0000269|PubMed:9430595}.
Function -- GeneRIF ? help Back to Top
  1. ANR1 expression in roots of hydroponically grown Arabidopsis plants was specifically regulated by changes in the N supply, being induced by N deprivation and rapidly repressed by N re-supply.
    [PMID: 16021502]
  2. There is evidence for a nitrate-dependent component of the ANR1 signalling pathway.
    [PMID: 16339770]
  3. ANR1 overexpression accelerates early seedling development.
    [PMID: 22523192]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G14210.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by nitrate in root cell culture, (PubMed:9430595, PubMed:17148611). In roots, seems induced by nitrogen (N) deprivation (e.g. nitrate free medium) but rapidly repressed by N re-supply (e.g. nitrate, glutamine and ammonium) (PubMed:16021502). Slight repression in shoots during nitrogen (N) deprivation. {ECO:0000269|PubMed:16021502, ECO:0000269|PubMed:17148611, ECO:0000269|PubMed:9430595}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
BioGRIDAT2G45660, AT3G57230, AT4G37940
IntActSearch Q9SI38
Phenotype -- Disruption Phenotype ? help Back to Top
Source Description
UniProtDISRUPTION PHENOTYPE: Impaired lateral root proliferation in nitrate rich root zones. {ECO:0000269|PubMed:16021502, ECO:0000269|PubMed:9430595}.
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G14210
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2282440.0AK228244.1 Arabidopsis thaliana mRNA for hypothetical protein, complete cds, clone: RAFL14-69-G23.
GenBankBT0058610.0BT005861.1 Arabidopsis thaliana At2g14210 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_179033.11e-171AGAMOUS-like 44
SwissprotQ9SI381e-172ANR1_ARATH; MADS-box transcription factor ANR1
TrEMBLA0A178VW211e-168A0A178VW21_ARATH; ANR1
STRINGAT2G14210.11e-171(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM53024105
Representative plantOGRP1617761
Publications ? help Back to Top
  1. Zhang H,Forde BG
    Regulation of Arabidopsis root development by nitrate availability.
    J. Exp. Bot., 2000. 51(342): p. 51-9
    [PMID:10938795]
  2. Wang R,Guegler K,LaBrie ST,Crawford NM
    Genomic analysis of a nutrient response in Arabidopsis reveals diverse expression patterns and novel metabolic and potential regulatory genes induced by nitrate.
    Plant Cell, 2000. 12(8): p. 1491-509
    [PMID:10948265]
  3. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  4. Parenicov√° L, et al.
    Molecular and phylogenetic analyses of the complete MADS-box transcription factor family in Arabidopsis: new openings to the MADS world.
    Plant Cell, 2003. 15(7): p. 1538-51
    [PMID:12837945]
  5. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  6. Filleur S,Walch-Liu P,Gan Y,Forde BG
    Nitrate and glutamate sensing by plant roots.
    Biochem. Soc. Trans., 2005. 33(Pt 1): p. 283-6
    [PMID:15667327]
  7. de Folter S, et al.
    Comprehensive interaction map of the Arabidopsis MADS Box transcription factors.
    Plant Cell, 2005. 17(5): p. 1424-33
    [PMID:15805477]
  8. Gan Y,Filleur S,Rahman A,Gotensparre S,Forde BG
    Nutritional regulation of ANR1 and other root-expressed MADS-box genes in Arabidopsis thaliana.
    Planta, 2005. 222(4): p. 730-42
    [PMID:16021502]
  9. Walch-Liu P, et al.
    Nitrogen regulation of root branching.
    Ann. Bot., 2006. 97(5): p. 875-81
    [PMID:16339770]
  10. De Bodt S,Theissen G,Van de Peer Y
    Promoter analysis of MADS-box genes in eudicots through phylogenetic footprinting.
    Mol. Biol. Evol., 2006. 23(6): p. 1293-303
    [PMID:16581940]
  11. Leseberg CH,Li A,Kang H,Duvall M,Mao L
    Genome-wide analysis of the MADS-box gene family in Populus trichocarpa.
    Gene, 2006. 378: p. 84-94
    [PMID:16831523]
  12. Remans T, et al.
    The Arabidopsis NRT1.1 transporter participates in the signaling pathway triggering root colonization of nitrate-rich patches.
    Proc. Natl. Acad. Sci. U.S.A., 2006. 103(50): p. 19206-11
    [PMID:17148611]
  13. Zhang H,Rong H,Pilbeam D
    Signalling mechanisms underlying the morphological responses of the root system to nitrogen in Arabidopsis thaliana.
    J. Exp. Bot., 2007. 58(9): p. 2329-38
    [PMID:17578866]
  14. Walch-Liu P,Forde BG
    Nitrate signalling mediated by the NRT1.1 nitrate transporter antagonises L-glutamate-induced changes in root architecture.
    Plant J., 2008. 54(5): p. 820-8
    [PMID:18266918]
  15. Castaings L, et al.
    The nodule inception-like protein 7 modulates nitrate sensing and metabolism in Arabidopsis.
    Plant J., 2009. 57(3): p. 426-35
    [PMID:18826430]
  16. Feng H, et al.
    Multiple roles of nitrate transport accessory protein NAR2 in plants.
    Plant Signal Behav, 2011. 6(9): p. 1286-9
    [PMID:21852757]
  17. Gan Y,Bernreiter A,Filleur S,Abram B,Forde BG
    Overexpressing the ANR1 MADS-box gene in transgenic plants provides new insights into its role in the nitrate regulation of root development.
    Plant Cell Physiol., 2012. 53(6): p. 1003-16
    [PMID:22523192]
  18. Heyndrickx KS,Vandepoele K
    Systematic identification of functional plant modules through the integration of complementary data sources.
    Plant Physiol., 2012. 159(3): p. 884-901
    [PMID:22589469]
  19. Yan Y,Wang H,Hamera S,Chen X,Fang R
    miR444a has multiple functions in the rice nitrate-signaling pathway.
    Plant J., 2014. 78(1): p. 44-55
    [PMID:24460537]
  20. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]
  21. Lei L, et al.
    Nitrogen use efficiency is regulated by interacting proteins relevant to development in wheat.
    Plant Biotechnol. J., 2018. 16(6): p. 1214-1226
    [PMID:29193541]
  22. Sun CH, et al.
    Chrysanthemum MADS-box transcription factor CmANR1 modulates lateral root development via homo-/heterodimerization to influence auxin accumulation in Arabidopsis.
    Plant Sci., 2018. 266: p. 27-36
    [PMID:29241564]
  23. Zhang H,Forde BG
    An Arabidopsis MADS box gene that controls nutrient-induced changes in root architecture.
    Science, 1998. 279(5349): p. 407-9
    [PMID:9430595]