PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G06020.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family G2-like
Protein Properties Length: 301aa    MW: 33818.6 Da    PI: 5.9242
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G06020.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like97.59.8e-3186140155
      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                  k+rlrW+++LH++Fv+ave+LGG++kAtPk+++e+m+v+g++l+hvkSHLQk+Rl
  AT2G06020.1  86 KARLRWSSDLHDCFVNAVEKLGGPNKATPKSVKEAMEVEGIALHHVKSHLQKFRL 140
                  68****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.7E-2683140IPR009057Homeodomain-like
SuperFamilySSF466892.69E-1385140IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-2686141IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 301 aa     Download sequence    Send to blast
MKKQEKGNEV VTFEENPSTY VHHHTKKASM VLSEQEIEVI LQSNKETYNE KLEKNTKENA  60
EKVGIEEGNG SSSKITPCIF YTSDEKARLR WSSDLHDCFV NAVEKLGGPN KATPKSVKEA  120
MEVEGIALHH VKSHLQKFRL GKCNIRGGTN QYVRQSQSMP HKSQQQLQLN NDCVNHDSYC  180
NATFLSVTVP PTIDSLHQDT LNNTILFPTT LQAIPTSVSH NTYMSSYPSY NTVEVVKAQL  240
NALQDSSTSQ TQETFSRETN LSSIVTRDEA DPVDKYIDWN KVGETDIEHD SVEVLEALGL  300
K
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A7e-1786142258Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B7e-1786142258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A7e-1786142258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C7e-1786142258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D7e-1786142258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F7e-1786142258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H7e-1786142258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J7e-1786142258Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO183962260.0
Genevisible265520_at0.0
Expression AtlasAT2G06020-
AtGenExpressAT2G06020-
ATTED-IIAT2G06020-
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G06020.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G06020
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0064130.0AC006413.4 Arabidopsis thaliana chromosome 2 clone F5K7 map ve013, complete sequence.
GenBankCP0026850.0CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_178659.10.0Homeodomain-like superfamily protein
TrEMBLQ9ZPZ80.0Q9ZPZ8_ARATH; Homeodomain-like superfamily protein
STRINGAT2G06020.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM134061520
Representative plantOGRP7817262
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]