PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G04880.1
Common NameATWRKY1, F1O13.1, F28I8.34, WRKY1, ZAP1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family WRKY
Protein Properties Length: 487aa    MW: 54010.2 Da    PI: 6.9019
Description zinc-dependent activator protein-1
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G04880.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY96.12.3e-30110168160
                  ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
         WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                  ++DgynWrKYGqK vkg+ef rsYYrCt+++C++kk++ersa  ++vv+++Y geH+h+k
  AT2G04880.1 110 MEDGYNWRKYGQKLVKGNEFVRSYYRCTHPNCKAKKQLERSA-GGQVVDTVYFGEHDHPK 168
                  58****************************************.***************85 PP

2WRKY106.41.4e-33306364159
                  ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
         WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                  ++Dgy+WrKYGqK+vkgs++prsYYrC+s+gCpvkk+vers++d+k++++tYeg+H+h+
  AT2G04880.1 306 VNDGYRWRKYGQKSVKGSPYPRSYYRCSSPGCPVKKHVERSSHDTKLLITTYEGKHDHD 364
                  58********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081122.492105169IPR003657WRKY domain
SuperFamilySSF1182909.81E-25106169IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.9E-26107169IPR003657WRKY domain
SMARTSM007746.3E-35110168IPR003657WRKY domain
PfamPF031068.5E-24111167IPR003657WRKY domain
Gene3DG3DSA:2.20.25.807.8E-35292366IPR003657WRKY domain
SuperFamilySSF1182908.89E-29300366IPR003657WRKY domain
PROSITE profilePS5081134.888301366IPR003657WRKY domain
SMARTSM007742.2E-39306365IPR003657WRKY domain
PfamPF031063.4E-26307363IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009863Biological Processsalicylic acid mediated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 487 aa     Download sequence    Send to blast
MAEVGKVLAS DMELDHSNET KAVDDVVATT DKAEVIPVAV TRTETVVESL ESTDCKELEK  60
LVPHTVASQS EVDVASPVSE KAPKVSESSG ALSLQSGSEG NSPFIREKVM EDGYNWRKYG  120
QKLVKGNEFV RSYYRCTHPN CKAKKQLERS AGGQVVDTVY FGEHDHPKPL AGAVPINQDK  180
RSDVFTAVSK GEQRIDIVSL IYKLCIVSYD IMFVEKTSGS SVQTLRQTEP PKIHGGLHVS  240
VIPPADDVKT DISQSSRITG DNTHKDYNSP TAKRRKKGGN IELSPVERST NDSRIVVHTQ  300
TLFDIVNDGY RWRKYGQKSV KGSPYPRSYY RCSSPGCPVK KHVERSSHDT KLLITTYEGK  360
HDHDMPPGRV VTHNNMLDSE VDDKEGDANK TPQSSTLQSI TKDQHVEDHL RKKTKTNGFE  420
KSLDQGPVLD EKLKEEIKER SDANKDHAAN HAKPEAKSDD KTTVCQEKAV GTLESEEQKP  480
KTEPAQS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A6e-50109368176WRKY transcription factor 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.711100.0inflorescence| seed
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1453599120.0
Genevisible263626_at0.0
Expression AtlasAT2G04880-
AtGenExpressAT2G04880-
ATTED-IIAT2G04880-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed to similar levels in root and flower, to a somewhat lower level in stem and to low levels in leaf and siliques. {ECO:0000269|PubMed:8972846}.
Functional Description ? help Back to Top
Source Description
TAIREncodes WRKY1, a member of the WRKY transcription factors in plants involved in disease resistance, abiotic stress, senescence as well as in some developmental processes. WRKY1 is involved in the salicylic acid signaling pathway. The crystal structure of the WRKY1 C-terminal domain revealed a zinc-binding site and identified the DNA-binding residues of WRKY1.
UniProtTranscription factor. Binds to a 5'-CGTTGACCGAG-3' consensus core sequence which contains a W box, a frequently occurring elicitor-responsive cis-acting element. {ECO:0000269|PubMed:8972846}.
Function -- GeneRIF ? help Back to Top
  1. The preliminary X-ray analysis was undertaken. The crystal diffracted to 2.50 A resolution in-house and belongs to space group P2(1)
    [PMID: 15935985]
  2. A molecular model of WRKY1 protein-DNA complex from site-directed mutagenesis studies.
    [PMID: 17264121]
  3. The role of WRKY1 in gene expression and stomatal closure under drought stress are reported.
    [PMID: 26820136]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00094SELEX26531826Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G04880.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By salicylic acid (SA). {ECO:0000269|PubMed:17264121}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDsalicylic acid
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G04880
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF4423890.0AF442389.1 Arabidopsis thaliana WRKY transcription factor 1 splice variant 1 (WRKY1) mRNA, complete cds; alternatively spliced.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_178565.10.0zinc-dependent activator protein-1
SwissprotQ9SI370.0WRKY1_ARATH; WRKY transcription factor 1
TrEMBLC0SV430.0C0SV43_ARATH; Uncharacterized protein At2g04880 (Fragment)
STRINGAT2G04880.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM79492639
Representative plantOGRP1417875
Publications ? help Back to Top
  1. Eulgem T,Rushton PJ,Robatzek S,Somssich IE
    The WRKY superfamily of plant transcription factors.
    Trends Plant Sci., 2000. 5(5): p. 199-206
    [PMID:10785665]
  2. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  3. Chen IP,Haehnel U,Altschmied L,Schubert I,Puchta H
    The transcriptional response of Arabidopsis to genotoxic stress - a high-density colony array study (HDCA).
    Plant J., 2003. 35(6): p. 771-86
    [PMID:12969430]
  4. Leonhardt N, et al.
    Microarray expression analyses of Arabidopsis guard cells and isolation of a recessive abscisic acid hypersensitive protein phosphatase 2C mutant.
    Plant Cell, 2004. 16(3): p. 596-615
    [PMID:14973164]
  5. Duan MR, et al.
    Crystallization and preliminary X-ray analysis of the C-terminal WRKY domain of Arabidopsis thaliana WRKY1 transcription factor.
    Biochim. Biophys. Acta, 2005. 1750(1): p. 14-6
    [PMID:15935985]
  6. Duan MR, et al.
    DNA binding mechanism revealed by high resolution crystal structure of Arabidopsis thaliana WRKY1 protein.
    Nucleic Acids Res., 2007. 35(4): p. 1145-54
    [PMID:17264121]
  7. Apuya NR, et al.
    Enhancement of alkaloid production in opium and California poppy by transactivation using heterologous regulatory factors.
    Plant Biotechnol. J., 2008. 6(2): p. 160-75
    [PMID:17961129]
  8. Ascencio-Ib
    Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection.
    Plant Physiol., 2008. 148(1): p. 436-54
    [PMID:18650403]
  9. Reiland S, et al.
    Large-scale Arabidopsis phosphoproteome profiling reveals novel chloroplast kinase substrates and phosphorylation networks.
    Plant Physiol., 2009. 150(2): p. 889-903
    [PMID:19376835]
  10. Shin R,Jez JM,Basra A,Zhang B,Schachtman DP
    14-3-3 proteins fine-tune plant nutrient metabolism.
    FEBS Lett., 2011. 585(1): p. 143-7
    [PMID:21094157]
  11. de Brevern AG,Joseph AP
    Species specific amino acid sequence-protein local structure relationships: An analysis in the light of a structural alphabet.
    J. Theor. Biol., 2011. 276(1): p. 209-17
    [PMID:21333657]
  12. Wang Q, et al.
    WRKY gene family evolution in Arabidopsis thaliana.
    Genetica, 2011. 139(8): p. 973-83
    [PMID:21805321]
  13. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  14. Qiao Z,Li CL,Zhang W
    WRKY1 regulates stomatal movement in drought-stressed Arabidopsis thaliana.
    Plant Mol. Biol., 2016. 91(1-2): p. 53-65
    [PMID:26820136]
  15. Aamir M, et al.
    Structural and Functional Insights into WRKY3 and WRKY4 Transcription Factors to Unravel the WRKY-DNA (W-Box) Complex Interaction in Tomato (Solanum lycopersicum L.). A Computational Approach.
    Front Plant Sci, 2017. 8: p. 819
    [PMID:28611792]
  16. de Pater S,Greco V,Pham K,Memelink J,Kijne J
    Characterization of a zinc-dependent transcriptional activator from Arabidopsis.
    Nucleic Acids Res., 1996. 24(23): p. 4624-31
    [PMID:8972846]