PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G03500.1
Common NameEFM, T4M8.7
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family G2-like
Protein Properties Length: 432aa    MW: 47961.8 Da    PI: 7.1257
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G03500.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.55.4e-32233288156
      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                  k+r++W+p+LH+rFv+a++ LGGs++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  AT2G03500.1 233 KARRCWSPDLHRRFVQALQMLGGSQVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 288
                  68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.682230290IPR017930Myb domain
SuperFamilySSF466892.2E-17231291IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.0E-28231291IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-26233288IPR006447Myb domain, plants
PfamPF002493.6E-7235286IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009266Biological Processresponse to temperature stimulus
GO:0009740Biological Processgibberellic acid mediated signaling pathway
GO:0009908Biological Processflower development
GO:0010452Biological Processhistone H3-K36 methylation
GO:0048579Biological Processnegative regulation of long-day photoperiodism, flowering
GO:1903507Biological Processnegative regulation of nucleic acid-templated transcription
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000293anatomyguard cell
PO:0005417anatomyphloem
PO:0009005anatomyroot
PO:0009025anatomyvascular leaf
PO:0009030anatomycarpel
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0020100anatomyhypocotyl
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 432 aa     Download sequence    Send to blast
MASSSELSLD CKPQSYSMLL KSFGDNFQSD PTTHKLEDLL SRLEQERLKI DAFKRELPLC  60
MQLLNNAVEV YKQQLEAYRA NSNNNNQSVG TRPVLEEFIP LRNQPEKTNN KGSNWMTTAQ  120
LWSQSETKPK NIDSTTDQSL PKDEINSSPK LGHFDAKQRN GSGAFLPFSK EQSLPELALS  180
TEVKRVSPTN EHTNGQDGND ESMINNDNNY NNNNNNNSNS NGVSSTTSQS NRKARRCWSP  240
DLHRRFVQAL QMLGGSQVAT PKQIRELMKV DGLTNDEVKS HLQKYRLHTR RPSPSPQTSG  300
GPGPHLVVLG GIWVPPEYTS AHGGTPTLYH HQVHHHHTNT AGPPPPHFCS SQEFYTTPPP  360
PQPLHHHHFQ TFNGSSGGTA STDSTHHQVT DSPTVEGKSP ESGGGERKGL AALREECEDH  420
SNINGSEITL KF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-14233286255Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-14233286255Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A2e-14233286154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-14233286154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-14233286154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-14233286154Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-14233286255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-14233286255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-14233286255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-14233286255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-14233286255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-14233286255Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO425689090.0
Genevisible265719_at0.0
Expression AtlasAT2G03500-
AtGenExpressAT2G03500-
ATTED-IIAT2G03500-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed 3 days after germination, with a gradual decrease before the floral transition and remains at low levels afterward. {ECO:0000269|PubMed:25132385}.
UniprotTISSUE SPECIFICITY: Specifically expressed in vascular tissues of cotyledons, rosette leaves and cauline leaves. Not detected in the vegetative shoot apical meristem. {ECO:0000269|PubMed:25132385}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor acting as a flowering repressor, directly repressing FT expression in a dosage-dependent manner in the leaf vasculature. {ECO:0000269|PubMed:25132385}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00261DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G03500.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by SVP. Down-regulated by high temperature and gibberellic acid treatment. Not regulated by photoperiod, circadian rhythm under long days or vernalization. {ECO:0000269|PubMed:25132385}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Interaction ? help Back to Top
Source Intact With
BioGRIDAT3G02150, AT3G47620, AT5G51910
IntActSearch Q9ZQ85
Phenotype -- Disruption Phenotype ? help Back to Top
Source Description
UniProtDISRUPTION PHENOTYPE: Early flowering under both long-day and short-day conditions. {ECO:0000269|PubMed:25132385}.
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G03500
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2216620.0AK221662.1 Arabidopsis thaliana mRNA for hypothetical protein, complete cds, clone: RAFL09-70-E23.
GenBankAY0605590.0AY060559.1 Arabidopsis thaliana At2g03500/T4M8.7 mRNA, complete cds.
GenBankAY1336300.0AY133630.1 Arabidopsis thaliana At2g03500/T4M8.7 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_027544.10.0Homeodomain-like superfamily protein
SwissprotQ9ZQ850.0EFM_ARATH; Myb family transcription factor EFM
TrEMBLA0A178VTV80.0A0A178VTV8_ARATH; Uncharacterized protein
STRINGAT2G03500.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM71342843
Representative plantOGRP43031624
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  3. Zhao C,Craig JC,Petzold HE,Dickerman AW,Beers EP
    The xylem and phloem transcriptomes from secondary tissues of the Arabidopsis root-hypocotyl.
    Plant Physiol., 2005. 138(2): p. 803-18
    [PMID:15923329]
  4. Arabidopsis Interactome Mapping Consortium
    Evidence for network evolution in an Arabidopsis interactome map.
    Science, 2011. 333(6042): p. 601-7
    [PMID:21798944]
  5. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  6. Yan Y, et al.
    A MYB-domain protein EFM mediates flowering responses to environmental cues in Arabidopsis.
    Dev. Cell, 2014. 30(4): p. 437-48
    [PMID:25132385]