PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G03340.1
Common NameT4M8.23, WRKY3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family WRKY
Protein Properties Length: 513aa    MW: 56284.1 Da    PI: 8.2331
Description WRKY DNA-binding protein 3
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G03340.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY108.53.2e-34250306259
                  --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
         WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                  dDgynWrKYGqK+vkgs+fprsYY+Ct++ Cpvkkkvers  d++v+ei+Y+g+Hnhe
  AT2G03340.1 250 DDGYNWRKYGQKQVKGSDFPRSYYKCTHPACPVKKKVERSL-DGQVTEIIYKGQHNHE 306
                  8****************************************.***************7 PP

2WRKY105.33.2e-33414472159
                  ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
         WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                  ldDgy+WrKYGqK+vkg+++prsYY+Ct+++C v+k+ver+a+dpk+v++tYeg+Hnh+
  AT2G03340.1 414 LDDGYRWRKYGQKVVKGNPYPRSYYKCTTPDCGVRKHVERAATDPKAVVTTYEGKHNHD 472
                  59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.808.0E-30241308IPR003657WRKY domain
PROSITE profilePS5081124.202244308IPR003657WRKY domain
SuperFamilySSF1182904.32E-26247308IPR003657WRKY domain
SMARTSM007742.3E-37249307IPR003657WRKY domain
PfamPF031065.8E-26250306IPR003657WRKY domain
Gene3DG3DSA:2.20.25.804.3E-36399474IPR003657WRKY domain
SuperFamilySSF1182902.48E-29406474IPR003657WRKY domain
PROSITE profilePS5081137.378409474IPR003657WRKY domain
SMARTSM007745.6E-38414473IPR003657WRKY domain
PfamPF031061.7E-25415472IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 513 aa     Download sequence    Send to blast
MAEKEEKEPS KLKSSTGVSR PTISLPPRPF GEMFFSGGVG FSPGPMTLVS NLFSDPDEFK  60
SFSQLLAGAM ASPAAAAVAA AAVVATAHHQ TPVSSVGDGG GSGGDVDPRF KQSRPTGLMI  120
TQPPGMFTVP PGLSPATLLD SPSFFGLFSP LQGTFGMTHQ QALAQVTAQA VQGNNVHMQQ  180
SQQSEYPSST QQQQQQQQQA SLTEIPSFSS APRSQIRASV QETSQGQRET SEISVFEHRS  240
QPQNADKPAD DGYNWRKYGQ KQVKGSDFPR SYYKCTHPAC PVKKKVERSL DGQVTEIIYK  300
GQHNHELPQK RGNNNGSCKS SDIANQFQTS NSSLNKSKRD QETSQVTTTE QMSEASDSEE  360
VGNAETSVGE RHEDEPDPKR RNTEVRVSEP VASSHRTVTE PRIIVQTTSE VDLLDDGYRW  420
RKYGQKVVKG NPYPRSYYKC TTPDCGVRKH VERAATDPKA VVTTYEGKHN HDVPAARTSS  480
HQLRPNNQHN TSTVNFNHQQ PVARLRLKEE QIT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-44224475578Probable WRKY transcription factor 4
2lex_A1e-44224475578Probable WRKY transcription factor 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.235870.0flower| silique
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1864990210.0
Genevisible265718_at0.0
Expression AtlasAT2G03340-
AtGenExpressAT2G03340-
ATTED-IIAT2G03340-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: In young, mature and senescent leaves. {ECO:0000269|PubMed:11722756}.
Functional Description ? help Back to Top
Source Description
TAIREncodes WRKY DNA-binding protein 3 (WRKY3).
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.
Function -- GeneRIF ? help Back to Top
  1. Data support that WRKY3 function as transcription factors and have a positive role in plant resistance to necrotrophic pathogens.
    [PMID: 18570649]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00260DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G03340.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By salicylic acid and during leaf senescence. {ECO:0000269|PubMed:11449049, ECO:0000269|PubMed:11722756}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source Target Gene (A: Activate/R: Repress)
ATRM AT1G17420(A), AT1G62300(A)
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G03340
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF2247010.0AF224701.1 Arabidopsis thaliana WRKY DNA-binding protein 3 (WRKY3) mRNA, complete cds.
GenBankAK2290360.0AK229036.1 Arabidopsis thaliana mRNA for putative WRKY DNA-binding protein, complete cds, clone: RAFL16-33-J05.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_178433.10.0WRKY DNA-binding protein 3
SwissprotQ9ZQ700.0WRKY3_ARATH; Probable WRKY transcription factor 3
TrEMBLQ0WPM80.0Q0WPM8_ARATH; Putative WRKY DNA-binding protein
STRINGAT2G03340.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1417875
MalvidsOGEM15342792
Publications ? help Back to Top
  1. Eulgem T,Rushton PJ,Robatzek S,Somssich IE
    The WRKY superfamily of plant transcription factors.
    Trends Plant Sci., 2000. 5(5): p. 199-206
    [PMID:10785665]
  2. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  3. Yu D,Chen C,Chen Z
    Evidence for an important role of WRKY DNA binding proteins in the regulation of NPR1 gene expression.
    Plant Cell, 2001. 13(7): p. 1527-40
    [PMID:11449049]
  4. Robatzek S,Somssich IE
    A new member of the Arabidopsis WRKY transcription factor family, AtWRKY6, is associated with both senescence- and defence-related processes.
    Plant J., 2001. 28(2): p. 123-33
    [PMID:11722756]
  5. Ma L,Zhao H,Deng XW
    Analysis of the mutational effects of the COP/DET/FUS loci on genome expression profiles reveals their overlapping yet not identical roles in regulating Arabidopsis seedling development.
    Development, 2003. 130(5): p. 969-81
    [PMID:12538522]
  6. Hoth S, et al.
    Monitoring genome-wide changes in gene expression in response to endogenous cytokinin reveals targets in Arabidopsis thaliana.
    FEBS Lett., 2003. 554(3): p. 373-80
    [PMID:14623097]
  7. Pischke MS,Huttlin EL,Hegeman AD,Sussman MR
    A transcriptome-based characterization of habituation in plant tissue culture.
    Plant Physiol., 2006. 140(4): p. 1255-78
    [PMID:16489130]
  8. Soitamo AJ,Piippo M,Allahverdiyeva Y,Battchikova N,Aro EM
    Light has a specific role in modulating Arabidopsis gene expression at low temperature.
    BMC Plant Biol., 2008. 8: p. 13
    [PMID:18230142]
  9. Lai Z,Vinod K,Zheng Z,Fan B,Chen Z
    Roles of Arabidopsis WRKY3 and WRKY4 transcription factors in plant responses to pathogens.
    BMC Plant Biol., 2008. 8: p. 68
    [PMID:18570649]
  10. Skibbe M,Qu N,Galis I,Baldwin IT
    Induced plant defenses in the natural environment: Nicotiana attenuata WRKY3 and WRKY6 coordinate responses to herbivory.
    Plant Cell, 2008. 20(7): p. 1984-2000
    [PMID:18641266]
  11. Jakoby MJ, et al.
    Transcriptional profiling of mature Arabidopsis trichomes reveals that NOECK encodes the MIXTA-like transcriptional regulator MYB106.
    Plant Physiol., 2008. 148(3): p. 1583-602
    [PMID:18805951]
  12. Miller MJ,Barrett-Wilt GA,Hua Z,Vierstra RD
    Proteomic analyses identify a diverse array of nuclear processes affected by small ubiquitin-like modifier conjugation in Arabidopsis.
    Proc. Natl. Acad. Sci. U.S.A., 2010. 107(38): p. 16512-7
    [PMID:20813957]
  13. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]