PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G03060.2
Common NameAGL30
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family M-type_MADS
Protein Properties Length: 386aa    MW: 43789.1 Da    PI: 6.9025
Description AGAMOUS-like 30
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G03060.2genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF65.45.7e-211053245
                 ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
       SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                 + en+  rq tf+kR+ngilKKA+ELS+LCd+++ +++fs+tgk
  AT2G03060.2 10 KLENTNGRQSTFAKRKNGILKKANELSILCDIDIVLLMFSPTGK 53
                 6799**************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.4E-31160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006624.334153IPR002100Transcription factor, MADS-box
CDDcd002661.67E-24282No hitNo description
SuperFamilySSF554551.7E-25294IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-17323IPR002100Transcription factor, MADS-box
PfamPF003191.2E-181153IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-172338IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-173859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010152Biological Processpollen maturation
GO:0080092Biological Processregulation of pollen tube growth
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
GO:0046983Molecular Functionprotein dimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000293anatomyguard cell
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0025022anatomycollective leaf structure
PO:0025195anatomypollen tube cell
PO:0025281anatomypollen
PO:0001017developmental stageM germinated pollen stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 386 aa     Download sequence    Send to blast
MGRVKLKIKK LENTNGRQST FAKRKNGILK KANELSILCD IDIVLLMFSP TGKAAICCGT  60
RSSMEEVIAK FSQVTPQERT KRKFESLENL KKTFQKLDHD VNIREFIASS NSTVEDLSTQ  120
ARILQARISE IHGRLSYWTE PDKINNVEHL GQLEISIRQS LDQLRAHKEH FGQQQQAMQI  180
ENANFVKDWS TCSMQDGIQI PLEQQLQSMS WILNSNTTNI VTEEHNSIPQ REVECSASSS  240
FGSYPGYFGT GKSPEMTIPG QETSFLDELN TGQLKQDTSS QQQFTNNNNI TAYNPNLHND  300
MNHHQTLPPP PLPLTLPHAQ VYIPMNQREY HMNGFFEAPP PDSSAYNDNT NQTRFGSSSS  360
SLPCSISMFD EYLFSQVTKT KLSQRF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6byy_A2e-12192190MEF2 CHIMERA
6byy_B2e-12192190MEF2 CHIMERA
6byy_C2e-12192190MEF2 CHIMERA
6byy_D2e-12192190MEF2 CHIMERA
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.414330.0flower
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO3341841160.0
Genevisible266793_at0.0
Expression AtlasAT2G03060-
AtGenExpressAT2G03060-
ATTED-IIAT2G03060-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in pollen. {ECO:0000269|PubMed:12949148}.
Functional Description ? help Back to Top
Source Description
TAIREncodes a member of the MIKC (MADS box, Keratin binding domain, and C terminal domain containing )family of transcriptional regulators. AGL30 is expressed in pollen.It forms heterodimers with other MICK family members.
UniProtProbable transcription factor that forms heterodimers with the MADS-box proteins AGL66 and AGL104 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth. {ECO:0000269|PubMed:19211705}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G03060.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G03060
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ4464590.0DQ446459.1 Arabidopsis thaliana clone pENTR221-At2g03060 MADS-box family protein (At2g03060) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001318187.10.0AGAMOUS-like 30
SwissprotQ1PFA40.0AGL30_ARATH; Agamous-like MADS-box protein AGL30
TrEMBLF4IS820.0F4IS82_ARATH; AGAMOUS-like 30
STRINGAT2G03060.20.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM87542539
Representative plantOGRP59461119
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. De Bodt S, et al.
    Genomewide structural annotation and evolutionary analysis of the type I MADS-box genes in plants.
    J. Mol. Evol., 2003. 56(5): p. 573-86
    [PMID:12698294]
  3. Parenicov√° L, et al.
    Molecular and phylogenetic analyses of the complete MADS-box transcription factor family in Arabidopsis: new openings to the MADS world.
    Plant Cell, 2003. 15(7): p. 1538-51
    [PMID:12837945]
  4. Kofuji R, et al.
    Evolution and divergence of the MADS-box gene family based on genome-wide expression analyses.
    Mol. Biol. Evol., 2003. 20(12): p. 1963-77
    [PMID:12949148]
  5. Becker JD,Boavida LC,Carneiro J,Haury M,Feij
    Transcriptional profiling of Arabidopsis tissues reveals the unique characteristics of the pollen transcriptome.
    Plant Physiol., 2003. 133(2): p. 713-25
    [PMID:14500793]
  6. Gong W, et al.
    Genome-wide ORFeome cloning and analysis of Arabidopsis transcription factor genes.
    Plant Physiol., 2004. 135(2): p. 773-82
    [PMID:15208423]
  7. de Folter S, et al.
    Comprehensive interaction map of the Arabidopsis MADS Box transcription factors.
    Plant Cell, 2005. 17(5): p. 1424-33
    [PMID:15805477]
  8. Pina C,Pinto F,Feij
    Gene family analysis of the Arabidopsis pollen transcriptome reveals biological implications for cell growth, division control, and gene expression regulation.
    Plant Physiol., 2005. 138(2): p. 744-56
    [PMID:15908605]
  9. Verelst W,Saedler H,M√ľnster T
    MIKC* MADS-protein complexes bind motifs enriched in the proximal region of late pollen-specific Arabidopsis promoters.
    Plant Physiol., 2007. 143(1): p. 447-60
    [PMID:17071640]
  10. Underwood BA,Vanderhaeghen R,Whitford R,Town CD,Hilson P
    Simultaneous high-throughput recombinational cloning of open reading frames in closed and open configurations.
    Plant Biotechnol. J., 2006. 4(3): p. 317-24
    [PMID:17147637]
  11. Panjabi P, et al.
    Comparative mapping of Brassica juncea and Arabidopsis thaliana using Intron Polymorphism (IP) markers: homoeologous relationships, diversification and evolution of the A, B and C Brassica genomes.
    BMC Genomics, 2008. 9: p. 113
    [PMID:18315867]
  12. Wang Y, et al.
    Transcriptome analyses show changes in gene expression to accompany pollen germination and tube growth in Arabidopsis.
    Plant Physiol., 2008. 148(3): p. 1201-11
    [PMID:18775970]
  13. Adamczyk BJ,Fernandez DE
    MIKC* MADS domain heterodimers are required for pollen maturation and tube growth in Arabidopsis.
    Plant Physiol., 2009. 149(4): p. 1713-23
    [PMID:19211705]
  14. Chen G, et al.
    Brassica napus TT16 homologs with different genomic origins and expression levels encode proteins that regulate a broad range of endothelium-associated genes at the transcriptional level.
    Plant J., 2013. 74(4): p. 663-77
    [PMID:23425240]
  15. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]