PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G02540.1
Common NameATHB21, HB21, T8K22.16, ZFHD4, ZHD3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family ZF-HD
Protein Properties Length: 310aa    MW: 34715.9 Da    PI: 8.4011
Description homeobox protein 21
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G02540.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer99.82e-3185140460
  ZF-HD_dimer   4 vrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60 
                  ++YkeClkNhAa++Gg+a+DGCgEfmps geeg+++al+C+ C+CHRnFHRre+e e
  AT2G02540.1  85 IKYKECLKNHAATMGGNAIDGCGEFMPS-GEEGSIEALTCSVCNCHRNFHRRETEGE 140
                  79*************************9.999*********************9865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257742.0E-2785140IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047701.1E-2885137IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015661.9E-3086136IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.22587136IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466891.12E-20210283IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.4E-31214284IPR009057Homeodomain-like
PROSITE profilePS500718.875220284IPR001356Homeobox domain
TIGRFAMsTIGR015651.0E-25222279IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0046872Molecular Functionmetal ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000014anatomyrosette leaf
PO:0000037anatomyshoot apex
PO:0000293anatomyguard cell
PO:0009005anatomyroot
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009015anatomyportion of vascular tissue
PO:0009025anatomyvascular leaf
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0025022anatomycollective leaf structure
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 310 aa     Download sequence    Send to blast
MEIASQEDPI PINTSYGNSG GGHGNMNHHH HANSAPSSLN ITTSNPLLVS SNSNGLGKNH  60
DHSHHHHVGY NIMVTNIKKE KPVVIKYKEC LKNHAATMGG NAIDGCGEFM PSGEEGSIEA  120
LTCSVCNCHR NFHRRETEGE EKTFFSPYLN HHQPPPQQRK LMFHHKMIKS PLPQQMIMPI  180
GVTTAGSNSE SEDLMEEEGG GSLTFRQPPP PPSPYSYGHN QKKRFRTKFT QEQKEKMISF  240
AERVGWKIQR QEESVVQQLC QEIGIRRRVL KVWMHNNKQN LSKKSNNVSN NVDLSAGNND  300
ITENLASTNP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A5e-232232801875ZF-HD homeobox family protein
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible267271_at0.0
Expression AtlasAT2G02540-
AtGenExpressAT2G02540-
ATTED-IIAT2G02540-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Mostly expressed in flowers and inflorescence. {ECO:0000269|PubMed:16428600}.
Functional Description ? help Back to Top
Source Description
TAIRZinc finger homeobox protein. Expressed in vascular tissue. In a yeast one hybrid system was not able to transactivate a reporter gene.
UniProtPutative transcription factor. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00258DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G02540.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Interaction ? help Back to Top
Source Intact With
BioGRIDAT2G36610, AT5G65410, AT1G26960, AT1G69600
IntActSearch O64722
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G02540
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0041360.0AC004136.3 Arabidopsis thaliana chromosome 2 BAC T8K22 genomic sequence, complete sequence.
GenBankCP0026850.0CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence.
GenBankAY7738340.0AY773834.1 Arabidopsis thaliana clone pENTR221-At2g02540 hypothetical protein (At2g02540) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_178358.10.0homeobox protein 21
SwissprotO647220.0ZHD3_ARATH; Zinc-finger homeodomain protein 3
TrEMBLR0FPG30.0R0FPG3_9BRAS; Uncharacterized protein
STRINGAT2G02540.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9116237
MalvidsOGEM33392665
Publications ? help Back to Top
  1. Windhövel A,Hein I,Dabrowa R,Stockhaus J
    Characterization of a novel class of plant homeodomain proteins that bind to the C4 phosphoenolpyruvate carboxylase gene of Flaveria trinervia.
    Plant Mol. Biol., 2001. 45(2): p. 201-14
    [PMID:11289511]
  2. Xiao YL,Malik M,Whitelaw CA,Town CD
    Cloning and sequencing of cDNAs for hypothetical genes from chromosome 2 of Arabidopsis.
    Plant Physiol., 2002. 130(4): p. 2118-28
    [PMID:12481096]
  3. Xiao YL, et al.
    Analysis of the cDNAs of hypothetical genes on Arabidopsis chromosome 2 reveals numerous transcript variants.
    Plant Physiol., 2005. 139(3): p. 1323-37
    [PMID:16244158]
  4. Tan QK,Irish VF
    The Arabidopsis zinc finger-homeodomain genes encode proteins with unique biochemical properties that are coordinately expressed during floral development.
    Plant Physiol., 2006. 140(3): p. 1095-108
    [PMID:16428600]
  5. Knight CA, et al.
    Expression profiling and local adaptation of Boechera holboellii populations for water use efficiency across a naturally occurring water stress gradient.
    Mol. Ecol., 2006. 15(5): p. 1229-37
    [PMID:16626450]
  6. Tran LS, et al.
    Co-expression of the stress-inducible zinc finger homeodomain ZFHD1 and NAC transcription factors enhances expression of the ERD1 gene in Arabidopsis.
    Plant J., 2007. 49(1): p. 46-63
    [PMID:17233795]
  7. Hu W,dePamphilis CW,Ma H
    Phylogenetic analysis of the plant-specific zinc finger-homeobox and mini zinc finger gene families.
    J Integr Plant Biol, 2008. 50(8): p. 1031-45
    [PMID:18713354]
  8. Barth O,Vogt S,Uhlemann R,Zschiesche W,Humbeck K
    Stress induced and nuclear localized HIPP26 from Arabidopsis thaliana interacts via its heavy metal associated domain with the drought stress related zinc finger transcription factor ATHB29.
    Plant Mol. Biol., 2009. 69(1-2): p. 213-26
    [PMID:18974936]
  9. Hong SY,Kim OK,Kim SG,Yang MS,Park CM
    Nuclear import and DNA binding of the ZHD5 transcription factor is modulated by a competitive peptide inhibitor in Arabidopsis.
    J. Biol. Chem., 2011. 286(2): p. 1659-68
    [PMID:21059647]
  10. We
    Convergent targeting of a common host protein-network by pathogen effectors from three kingdoms of life.
    Cell Host Microbe, 2014. 16(3): p. 364-75
    [PMID:25211078]