PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G02450.2
Common NameANAC034, ANAC035, AtLOV1, LOV1, NAC035
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NAC
Protein Properties Length: 414aa    MW: 47303.1 Da    PI: 6.6458
Description NAC domain containing protein 35
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G02450.2genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM163.76.6e-51521772128
          NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgel 99 
                  +pGfrFhPt+eel+ +yL++kvegk++++ e i+ +d+y+++Pw+Lp++++ +ekewyf+++rd+ky++g+r+nr+t+sgyWkatg d+ + s++++ 
  AT2G02450.2  52 MPGFRFHPTEEELIEFYLRRKVEGKRFNV-ELITFLDLYRYDPWELPAMAAIGEKEWYFYVPRDRKYRNGDRPNRVTTSGYWKATGADRMIRSETSRP 148
                  79***************************.89***************888889********************************************* PP

          NAM 100 vglkktLvfykgrapkgektdWvmheyrl 128
                  +glkktLvfy+g+apkg++t+W+m+eyrl
  AT2G02450.2 149 IGLKKTLVFYSGKAPKGTRTSWIMNEYRL 177
                  ***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.18E-5651198IPR003441NAC domain
PROSITE profilePS5100556.27251198IPR003441NAC domain
PfamPF023653.0E-2553177IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009908Biological Processflower development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0001054developmental stagevascular leaf senescent stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 414 aa     Download sequence    Send to blast
MAIVSSTTSI IPMSNQVNNN EKGIEDNDHR GGQESHVQNE DEADDHDHDM VMPGFRFHPT  60
EEELIEFYLR RKVEGKRFNV ELITFLDLYR YDPWELPAMA AIGEKEWYFY VPRDRKYRNG  120
DRPNRVTTSG YWKATGADRM IRSETSRPIG LKKTLVFYSG KAPKGTRTSW IMNEYRLPHH  180
ETEKYQKAEI SLCRVYKRPG VEDHPSVPRS LSTRHHNHNS STSSRLALRQ QQHHSSSSNH  240
SDNNLNNNNN INNLEKLSTE YSGDGSTTTT TTNSNSDVTI ALANQNIYRP MPYDTSNNTL  300
IVSTRNHQDD DETAIVDDLQ RLVNYQISDG GNINHQYFQI AQQFHHTQQQ NANANALQLV  360
AAATTATTLM PQTQAALAMN MIPAGTIPNN ALWDMWNPIV PDGNRDHYTN IPFK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A4e-57421988165NO APICAL MERISTEM PROTEIN
1ut4_B4e-57421988165NO APICAL MERISTEM PROTEIN
1ut7_A4e-57421988165NO APICAL MERISTEM PROTEIN
1ut7_B4e-57421988165NO APICAL MERISTEM PROTEIN
3swm_A5e-574219811168NAC domain-containing protein 19
3swm_B5e-574219811168NAC domain-containing protein 19
3swm_C5e-574219811168NAC domain-containing protein 19
3swm_D5e-574219811168NAC domain-containing protein 19
3swp_A5e-574219811168NAC domain-containing protein 19
3swp_B5e-574219811168NAC domain-containing protein 19
3swp_C5e-574219811168NAC domain-containing protein 19
3swp_D5e-574219811168NAC domain-containing protein 19
4dul_A4e-57421988165NAC domain-containing protein 19
4dul_B4e-57421988165NAC domain-containing protein 19
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible266175_at0.0
Expression AtlasAT2G02450-
AtGenExpressAT2G02450-
ATTED-IIAT2G02450-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in aerial organs in early stages of seedling development. {ECO:0000269|PubMed:17653269}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that acts as a floral repressor. Controls flowering time by negatively regulating CONSTANS (CO) expression in a GIGANTEA (GI)-independent manner. Regulates the plant cold response by positive regulation of the cold response genes COR15A and KIN1. May coordinate cold response and flowering time. {ECO:0000269|PubMed:17653269}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00257DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G02450.2
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Circadian regulation with a peak of expression at dawn under continuous light conditions (PubMed:17653269). Circadian regulation with a peak of expression around dusk and lowest expression around dawn under continuous light conditions (at protein level) (PubMed:17653269). {ECO:0000269|PubMed:17653269}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source Target Gene (A: Activate/R: Repress)
ATRM AT5G15840(R)
Phenotype -- Disruption Phenotype ? help Back to Top
Source Description
UniProtDISRUPTION PHENOTYPE: Early flowering phenotype under long-day conditions. Hypersensitivity to cold. {ECO:0000269|PubMed:17653269}.
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G02450
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0008740.0BT000874.1 Arabidopsis thaliana clone C104984 putative NAM (no apical meristem) protein (At2g02450) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_565284.30.0protein LONG VEGETATIVE PHASE 1
TrEMBLQ9ZVP80.0Q9ZVP8_ARATH; NAC domain containing protein 35
STRINGAT2G02450.20.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1715800
MalvidsOGEM54362750
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  3. Leonhardt N, et al.
    Microarray expression analyses of Arabidopsis guard cells and isolation of a recessive abscisic acid hypersensitive protein phosphatase 2C mutant.
    Plant Cell, 2004. 16(3): p. 596-615
    [PMID:14973164]
  4. Ooka H, et al.
    Comprehensive analysis of NAC family genes in Oryza sativa and Arabidopsis thaliana.
    DNA Res., 2003. 10(6): p. 239-47
    [PMID:15029955]
  5. Czechowski T,Bari RP,Stitt M,Scheible WR,Udvardi MK
    Real-time RT-PCR profiling of over 1400 Arabidopsis transcription factors: unprecedented sensitivity reveals novel root- and shoot-specific genes.
    Plant J., 2004. 38(2): p. 366-79
    [PMID:15078338]
  6. Suh MC, et al.
    Cuticular lipid composition, surface structure, and gene expression in Arabidopsis stem epidermis.
    Plant Physiol., 2005. 139(4): p. 1649-65
    [PMID:16299169]
  7. Yoo SY,Kim Y,Kim SY,Lee JS,Ahn JH
    Control of flowering time and cold response by a NAC-domain protein in Arabidopsis.
    PLoS ONE, 2007. 2(7): p. e642
    [PMID:17653269]
  8. Abdeen A,Schnell J,Miki B
    Transcriptome analysis reveals absence of unintended effects in drought-tolerant transgenic plants overexpressing the transcription factor ABF3.
    BMC Genomics, 2010. 11: p. 69
    [PMID:20105335]
  9. Meinke DW
    A survey of dominant mutations in Arabidopsis thaliana.
    Trends Plant Sci., 2013. 18(2): p. 84-91
    [PMID:22995285]
  10. Suetsugu N,Kong SG,Kasahara M,Wada M
    Both LOV1 and LOV2 domains of phototropin2 function as the photosensory domain for hypocotyl phototropic responses in Arabidopsis thaliana (Brassicaceae).
    Am. J. Bot., 2013. 100(1): p. 60-9
    [PMID:23196397]
  11. Xu B, et al.
    Overexpression of AtLOV1 in Switchgrass alters plant architecture, lignin content, and flowering time.
    PLoS ONE, 2012. 7(12): p. e47399
    [PMID:23300513]
  12. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]