PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G02060.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family G2-like
Protein Properties Length: 256aa    MW: 28612.7 Da    PI: 7.1376
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G02060.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like104.85.1e-333082254
      G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYR 54
                 prlrWtp+LH++Fv+ave LGG+++AtPk +l++m+vkgLt++hvkSHLQ+YR
  AT2G02060.1 30 PRLRWTPDLHRCFVHAVEILGGQHRATPKLVLKMMDVKGLTISHVKSHLQMYR 82
                 8**************************************************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.1E-302682IPR009057Homeodomain-like
PROSITE profilePS5129412.2922686IPR017930Myb domain
TIGRFAMsTIGR015575.4E-233082IPR006447Myb domain, plants
SuperFamilySSF466895.02E-153082IPR009057Homeodomain-like
PfamPF002499.3E-93182IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0016740Molecular Functiontransferase activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000084anatomyplant sperm cell
PO:0000293anatomyguard cell
Sequence ? help Back to Top
Protein Sequence    Length: 256 aa     Download sequence    Send to blast
MGKSSGRNGN GSFNGNKFHG VRPYVRSPVP RLRWTPDLHR CFVHAVEILG GQHRATPKLV  60
LKMMDVKGLT ISHVKSHLQM YRGGSKLTLE KPEESSSSSI RRRQDSEEDY YLHDNLSLHT  120
RNDCLLGFHS FPLSSHSSFR GGGGGRTKEQ QTSESGGYDD DADFLHIKKM NDTTTFLSHH  180
FPKGTEEWRE QEHEEEEEDL SLSLSLNHHH WRSNGSSVVS ETSEAAVSTC SAPFVSKDCF  240
GSSKIDLNLS ISLLGS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A5e-183182354Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B5e-183182354Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C5e-183182354Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D5e-183182354Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.415200.0silique
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasAT2G02060
AtGenExpressAT2G02060
ATTED-IIAT2G02060
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G02060.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G02060
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2295110.0AK229511.1 Arabidopsis thaliana mRNA for hypothetical protein, complete cds, clone: RAFL17-14-B12.
GenBankBT0085560.0BT008556.1 Arabidopsis thaliana clone U50358 unknown protein (At2g02060) mRNA, complete cds.
GenBankBT0086990.0BT008699.1 Arabidopsis thaliana clone RAFL17-14-B12 (R50358) unknown protein (At2g02060) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001324905.10.0Homeodomain-like superfamily protein
RefseqNP_565281.20.0Homeodomain-like superfamily protein
SwissprotQ700D93e-66MYBF_ARATH; Putative Myb family transcription factor At1g14600
TrEMBLQ7X8870.0Q7X887_ARATH; Glycosyltransferase
STRINGAT2G02060.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM46941852
Representative plantOGRP28515123
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Egelund J, et al.
    Molecular characterization of two Arabidopsis thaliana glycosyltransferase mutants, rra1 and rra2, which have a reduced residual arabinose content in a polymer tightly associated with the cellulosic wall residue.
    Plant Mol. Biol., 2007. 64(4): p. 439-51
    [PMID:17401635]
  3. Lao J, et al.
    The plant glycosyltransferase clone collection for functional genomics.
    Plant J., 2014. 79(3): p. 517-29
    [PMID:24905498]