PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G01930.1
Common NameATBPC1, BBR, BPC1, F23I14.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family BBR-BPC
Protein Properties Length: 283aa    MW: 31648 Da    PI: 10.2151
Description basic pentacysteine1
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G01930.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind371.31.8e-11312831301
    GAGA_bind   1 mdddgsrernkgyyepa..aslkenlglqlmssiaerdaki....rernlalsekkaavaerd..maflqrdkalaernkalverdnkllalllvens 90 
                  mdddg+  rn+gyyepa  +s+k nlglqlms+i +r++k+    re+nl ++++++++++r+  m++    +++++      ++dnk++++l++++ 
  AT2G01930.1   1 MDDDGF--RNWGYYEPAaaSSFKGNLGLQLMSTI-DRNTKPflpgRESNL-MIGSNGSYHSREqdMNY----SWINQ------PKDNKFFNMLPIST- 83 
                  99**99..9******99889**************.9**************.********998755999....*****......***********766. PP

    GAGA_bind  91 lasalpvgvqvlsgtksidslqqlsepqledsavelreeeklealpieeaaeeakekkkkkkrqrakkpkekkakkkkkksekskkkvkkesadersk 188
                       p++++vls+t+  +s+q++++p l+ s +e    e+   +p  +++++ k++k++ + +++++pk+kk++k+k+++++++++v++++  +r+k
  AT2G01930.1  84 -----PSYSNVLSETSGSNSIQMIHQPVLNSSRFE----ENPIPPPAPCEEQTGKKRKMRGSIATPTVPKAKKMRKPKEERDVTNNNVQQQQ--QRVK 170
                  .....99*******************999999888....445678899999****************************9999999999888..89** PP

    GAGA_bind 189 aekksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmSqgafkklLekLaaeGydlsnpvDLk 286
                    kks+dlv+ngvs+D+s+lPvPvC+CtG+++qCY+WG+GGWqSaCCtt+iSvyPLP+stkrrgaRi+grKmSqgafkk+LekL++eGy+++n++DLk
  AT2G01930.1 171 PVKKSVDLVINGVSMDISGLPVPVCTCTGTPQQCYRWGCGGWQSACCTTNISVYPLPMSTKRRGARISGRKMSQGAFKKVLEKLSTEGYSFGNAIDLK 268
                  ************************************************************************************************** PP

    GAGA_bind 287 dhWAkHGtnkfvtir 301
                  +hWA+HGtnkfvtir
  AT2G01930.1 269 SHWARHGTNKFVTIR 283
                  **************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012263.3E-1801283IPR010409GAGA-binding transcriptional activator
PfamPF062172.1E-991283IPR010409GAGA-binding transcriptional activator
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0050793Biological Processregulation of developmental process
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000005anatomycultured plant cell
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000084anatomyplant sperm cell
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001016developmental stageL mature pollen stage
PO:0001017developmental stageM germinated pollen stage
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 283 aa     Download sequence    Send to blast
MDDDGFRNWG YYEPAAASSF KGNLGLQLMS TIDRNTKPFL PGRESNLMIG SNGSYHSREQ  60
DMNYSWINQP KDNKFFNMLP ISTPSYSNVL SETSGSNSIQ MIHQPVLNSS RFEENPIPPP  120
APCEEQTGKK RKMRGSIATP TVPKAKKMRK PKEERDVTNN NVQQQQQRVK PVKKSVDLVI  180
NGVSMDISGL PVPVCTCTGT PQQCYRWGCG GWQSACCTTN ISVYPLPMST KRRGARISGR  240
KMSQGAFKKV LEKLSTEGYS FGNAIDLKSH WARHGTNKFV TIR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.285590.0flower| leaf| seed
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible263305_at0.0
Expression AtlasAT2G01930-
AtGenExpressAT2G01930-
ATTED-IIAT2G01930-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Early detected in the floral meristem and floral organ primordia. At later stages, expressed in all floral organs and in particular in the ovule. {ECO:0000269|PubMed:15722463}.
UniprotTISSUE SPECIFICITY: Expressed in seedlings, leaves and pistils. Detected in the base of flowers and tips of carpels, in leaf and sepal vasculature, in young rosette, in the lateral and tip of primary roots, and in the whole ovule. {ECO:0000269|PubMed:14731261, ECO:0000269|PubMed:21435046}.
Functional Description ? help Back to Top
Source Description
TAIRBASIC PENTACYSTEINE1 (BPC1) is a regulator of the homeotic Arabidopsis thaliana gene SEEDSTICK (STK), which controls ovule identity. BPC1 induces conformational changes by cooperative binding to purine-rich elements present in the STK regulatory sequence. STK is upregulated in bpc1 mutant.
UniProtTranscriptional regulator that specifically binds to GA-rich elements (GAGA-repeats) present in regulatory sequences of genes involved in developmental processes. Negatively regulates the homeotic gene AGL11/STK, which controls ovule primordium identity, by a cooperative binding to purine-rich elements present in the regulatory sequence leading to DNA conformational changes. {ECO:0000269|PubMed:14731261, ECO:0000269|PubMed:15722463}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00253DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G01930.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source Target Gene (A: Activate/R: Repress)
ATRM AT4G09960(R)
Interaction ? help Back to Top
Source Intact With
BioGRIDAT2G01930, AT2G21240, AT5G42520
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G01930
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0072650.0AC007265.5 Arabidopsis thaliana chromosome 2 clone F23I14 map CIC11A04, complete sequence.
GenBankAY0652250.0AY065225.1 Arabidopsis thaliana unknown protein (At2g01930) mRNA, complete cds.
GenBankAY0965500.0AY096550.1 Arabidopsis thaliana unknown protein (At2g01930) mRNA, complete cds.
GenBankCP0026850.0CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_565279.10.0basic pentacysteine1
RefseqNP_973398.10.0basic pentacysteine1
SwissprotQ9SKD00.0BPC1_ARATH; Protein BASIC PENTACYSTEINE1
TrEMBLA0A178VWB70.0A0A178VWB7_ARATH; BPC1
STRINGAT2G01930.20.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM28932769
Representative plantOGRP18651240
Publications ? help Back to Top
  1. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  2. Meister RJ, et al.
    Definition and interactions of a positive regulatory element of the Arabidopsis INNER NO OUTER promoter.
    Plant J., 2004. 37(3): p. 426-38
    [PMID:14731261]
  3. Kooiker M, et al.
    BASIC PENTACYSTEINE1, a GA binding protein that induces conformational changes in the regulatory region of the homeotic Arabidopsis gene SEEDSTICK.
    Plant Cell, 2005. 17(3): p. 722-9
    [PMID:15722463]
  4. Hanada K, et al.
    Functional compensation of primary and secondary metabolites by duplicate genes in Arabidopsis thaliana.
    Mol. Biol. Evol., 2011. 28(1): p. 377-82
    [PMID:20736450]
  5. Wanke D, et al.
    Alanine zipper-like coiled-coil domains are necessary for homotypic dimerization of plant GAGA-factors in the nucleus and nucleolus.
    PLoS ONE, 2011. 6(2): p. e16070
    [PMID:21347358]
  6. Monfared MM, et al.
    Overlapping and antagonistic activities of BASIC PENTACYSTEINE genes affect a range of developmental processes in Arabidopsis.
    Plant J., 2011. 66(6): p. 1020-31
    [PMID:21435046]
  7. Simonini S, et al.
    Basic pentacysteine proteins mediate MADS domain complex binding to the DNA for tissue-specific expression of target genes in Arabidopsis.
    Plant Cell, 2012. 24(10): p. 4163-72
    [PMID:23054472]
  8. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]