PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G01760.1
Common NameARR14, RR14, T8O11.7
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family ARR-B
Protein Properties Length: 382aa    MW: 43099.1 Da    PI: 8.5805
Description response regulator 14
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G01760.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like86.13.5e-27200253155
      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                  k r++W+ eLH++Fv+av++L G++kA+Pk+ilelm+v+gL++e+v+SHLQk+Rl
  AT2G01760.1 200 KSRVVWSIELHQQFVNAVNKL-GIDKAVPKRILELMNVPGLSRENVASHLQKFRL 253
                  68*******************.********************************8 PP

2Response_reg76.31.1e-25131221109
                   EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTES CS
  Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGak 95 
                   +l+vdD+ + + +l+++l +  y +v+ +++++ al++l+e++  +Dl+l D+ mpgm+G++ll++    e++lp+i+++  g  +++   ++ Ga 
   AT2G01760.1  13 ILVVDDDTSCLFILEKMLLRLMY-QVTICSQADVALTILRERKdsFDLVLSDVHMPGMNGYNLLQQVGLLEMDLPVIMMSVDGRTTTVMTGINHGAC 108
                   89*********************.***************888889**************************************************** PP

                   EEEESS--HHHHHH CS
  Response_reg  96 dflsKpfdpeelvk 109
                   d+l Kp+ peel +
   AT2G01760.1 109 DYLIKPIRPEELKN 122
                   ***********987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363921.6E-1472379IPR017053Response regulator B-type, plant
SuperFamilySSF521728.11E-359144IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23009.0E-4110149No hitNo description
SMARTSM004483.5E-2811124IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011040.95412128IPR001789Signal transduction response regulator, receiver domain
PfamPF000722.5E-2213122IPR001789Signal transduction response regulator, receiver domain
CDDcd001569.59E-2714127No hitNo description
Gene3DG3DSA:1.10.10.605.5E-28197258IPR009057Homeodomain-like
PROSITE profilePS5129411.277197256IPR017930Myb domain
SuperFamilySSF466891.24E-18198257IPR009057Homeodomain-like
TIGRFAMsTIGR015571.8E-24200253IPR006447Myb domain, plants
PfamPF002491.2E-6202251IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009736Biological Processcytokinin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0000156Molecular Functionphosphorelay response regulator activity
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042802Molecular Functionidentical protein binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0006339anatomyjuvenile vascular leaf
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 382 aa     Download sequence    Send to blast
MPINDQFPSG LRILVVDDDT SCLFILEKML LRLMYQVTIC SQADVALTIL RERKDSFDLV  60
LSDVHMPGMN GYNLLQQVGL LEMDLPVIMM SVDGRTTTVM TGINHGACDY LIKPIRPEEL  120
KNIWQHVVRR KCVMKKELRS SQALEDNKNS GSLETVVVSV SECSEESLMK CRNKKKKKKR  180
SVDRDDNEDD LLLDPGNSKK SRVVWSIELH QQFVNAVNKL GIDKAVPKRI LELMNVPGLS  240
RENVASHLQK FRLYLKRLSG EASQSNDSES TKRYENIQAL VSSGQLHPQT LAALFGQPID  300
NHHSASFGVW IPNDNLGRSQ NEHFSVDVSS ASNRPVSVAV HGLSSSANFR QRGDVNNNRI  360
RQGYGSNVNE ESWILERSSR QR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A3e-19199259464ARR10-B
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1173179KKKKKKR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.424700.0flower
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO306779560.0
Genevisible265869_at0.0
Expression AtlasAT2G01760-
AtGenExpressAT2G01760-
ATTED-IIAT2G01760-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Predominantly expressed in young leaf tissue. {ECO:0000269|PubMed:15173562}.
Functional Description ? help Back to Top
Source Description
TAIRmember of Response Regulator: B- Type
UniProtTranscriptional activator that binds specifically to the DNA sequence 5'-[AG]GATT-3'. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. Could directly activate some type-A response regulators in response to cytokinins (By similarity). {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00098PBM26531826Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G01760.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Interaction ? help Back to Top
Source Intact With
BioGRIDAT2G23290, AT2G45660, AT3G14180, AT3G01220, AT4G08150, AT4G16110, AT4G16780, AT1G14920, AT1G21200, AT1G34370, AT1G67710
IntActSearch Q8L9Y3
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G01760
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0997260.0AY099726.1 Arabidopsis thaliana putative two-component response regulator protein (At2g01760) mRNA, complete cds.
GenBankAY1288870.0AY128887.1 Arabidopsis thaliana putative two-component response regulator protein (At2g01760) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_178285.10.0response regulator 14
SwissprotQ8L9Y30.0ARR14_ARATH; Two-component response regulator ARR14
TrEMBLA0A178VQ470.0A0A178VQ47_ARATH; Two-component response regulator
STRINGAT2G01760.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM81502736
Representative plantOGRP29217120
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Hwang I,Sheen J
    Two-component circuitry in Arabidopsis cytokinin signal transduction.
    Nature, 2001. 413(6854): p. 383-9
    [PMID:11574878]
  3. Hwang I,Chen HC,Sheen J
    Two-component signal transduction pathways in Arabidopsis.
    Plant Physiol., 2002. 129(2): p. 500-15
    [PMID:12068096]
  4. Imamura A,Kiba T,Tajima Y,Yamashino T,Mizuno T
    In vivo and in vitro characterization of the ARR11 response regulator implicated in the His-to-Asp phosphorelay signal transduction in Arabidopsis thaliana.
    Plant Cell Physiol., 2003. 44(2): p. 122-31
    [PMID:12610214]
  5. Heyl A,Schm
    Cytokinin signal perception and transduction.
    Curr. Opin. Plant Biol., 2003. 6(5): p. 480-8
    [PMID:12972049]
  6. Dal Bosco C, et al.
    Inactivation of the chloroplast ATP synthase gamma subunit results in high non-photochemical fluorescence quenching and altered nuclear gene expression in Arabidopsis thaliana.
    J. Biol. Chem., 2004. 279(2): p. 1060-9
    [PMID:14576160]
  7. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  8. Hoth S, et al.
    Monitoring genome-wide changes in gene expression in response to endogenous cytokinin reveals targets in Arabidopsis thaliana.
    FEBS Lett., 2003. 554(3): p. 373-80
    [PMID:14623097]
  9. Cluis CP,Mouchel CF,Hardtke CS
    The Arabidopsis transcription factor HY5 integrates light and hormone signaling pathways.
    Plant J., 2004. 38(2): p. 332-47
    [PMID:15078335]
  10. Mason MG,Li J,Mathews DE,Kieber JJ,Schaller GE
    Type-B response regulators display overlapping expression patterns in Arabidopsis.
    Plant Physiol., 2004. 135(2): p. 927-37
    [PMID:15173562]
  11. Brenner WG,Romanov GA,K
    Immediate-early and delayed cytokinin response genes of Arabidopsis thaliana identified by genome-wide expression profiling reveal novel cytokinin-sensitive processes and suggest cytokinin action through transcriptional cascades.
    Plant J., 2005. 44(2): p. 314-33
    [PMID:16212609]
  12. Mason MG, et al.
    Multiple type-B response regulators mediate cytokinin signal transduction in Arabidopsis.
    Plant Cell, 2005. 17(11): p. 3007-18
    [PMID:16227453]
  13. Pischke MS,Huttlin EL,Hegeman AD,Sussman MR
    A transcriptome-based characterization of habituation in plant tissue culture.
    Plant Physiol., 2006. 140(4): p. 1255-78
    [PMID:16489130]
  14. Thilmony R,Underwood W,He SY
    Genome-wide transcriptional analysis of the Arabidopsis thaliana interaction with the plant pathogen Pseudomonas syringae pv. tomato DC3000 and the human pathogen Escherichia coli O157:H7.
    Plant J., 2006. 46(1): p. 34-53
    [PMID:16553894]
  15. Dortay H,Mehnert N,B
    Analysis of protein interactions within the cytokinin-signaling pathway of Arabidopsis thaliana.
    FEBS J., 2006. 273(20): p. 4631-44
    [PMID:16965536]
  16. Ishida K,Yamashino T,Yokoyama A,Mizuno T
    Three type-B response regulators, ARR1, ARR10 and ARR12, play essential but redundant roles in cytokinin signal transduction throughout the life cycle of Arabidopsis thaliana.
    Plant Cell Physiol., 2008. 49(1): p. 47-57
    [PMID:18037673]
  17. Dortay H, et al.
    Toward an interaction map of the two-component signaling pathway of Arabidopsis thaliana.
    J. Proteome Res., 2008. 7(9): p. 3649-60
    [PMID:18642946]
  18. Nemoto K, et al.
    Autophosphorylation profiling of Arabidopsis protein kinases using the cell-free system.
    Phytochemistry, 2011. 72(10): p. 1136-44
    [PMID:21477822]
  19. Arabidopsis Interactome Mapping Consortium
    Evidence for network evolution in an Arabidopsis interactome map.
    Science, 2011. 333(6042): p. 601-7
    [PMID:21798944]
  20. Mar
    Large-scale identification of gibberellin-related transcription factors defines group VII ETHYLENE RESPONSE FACTORS as functional DELLA partners.
    Plant Physiol., 2014. 166(2): p. 1022-32
    [PMID:25118255]