PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G01570.1
Common NameF2I9.19, GRS, RGA, RGA1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family GRAS
Protein Properties Length: 587aa    MW: 64035.4 Da    PI: 5.6667
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G01570.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS442.43.1e-1352215811374
         GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetsekn.sseelaalklfsevsPilkfshlt 97 
                  lv++L++cAea+++++l+la+al++++  la +++ +m+++a+yf+eALa+r++r        l+p +++ ++  s++l++   f+e++P+lkf+h+t
  AT2G01570.1 221 LVHALMACAEAIQQNNLTLAEALVKQIGCLAVSQAGAMRKVATYFAEALARRIYR--------LSPPQNQIDHcLSDTLQM--HFYETCPYLKFAHFT 308
                  689****************************************************........444443322224444443..4************** PP

         GRAS  98 aNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLr 195
                  aNqaIlea+eg++rvH+iDf+++qGlQWpaL+qaLa R++gpp++R+Tg+g+p++++++ l+e+g +La++Ae+++v+fe++ +va++l+dl+ ++L+
  AT2G01570.1 309 ANQAILEAFEGKKRVHVIDFSMNQGLQWPALMQALALREGGPPTFRLTGIGPPAPDNSDHLHEVGCKLAQLAEAIHVEFEYRGFVANSLADLDASMLE 406
                  ************************************************************************************************** PP

         GRAS 196 vkp..gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellg 291
                  ++p   Ea+aVn+v++lh+ll +++ +e+    vL +vk+++P +++vveqe++hn++ Fl+rf+e+l+yys+lfdsle      +++++++++++lg
  AT2G01570.1 407 LRPsdTEAVAVNSVFELHKLLGRPGGIEK----VLGVVKQIKPVIFTVVEQESNHNGPVFLDRFTESLHYYSTLFDSLEGV---PNSQDKVMSEVYLG 497
                  ***999*******************9999....*********************************************998...68999999****** PP

         GRAS 292 reivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                  ++i+n+vaceg +r+erhetl++W +r++++G+ p++l+++a kqa++ll+ ++ ++gyrvee++g+l+lgW++rpL+++SaW+
  AT2G01570.1 498 KQICNLVACEGPDRVERHETLSQWGNRFGSSGLAPAHLGSNAFKQASMLLSVFNsGQGYRVEESNGCLMLGWHTRPLITTSAWK 581
                  ***********************************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF120414.9E-3544111IPR021914Transcriptional factor DELLA, N-terminal
SMARTSM011291.7E-4244117No hitNo description
PROSITE profilePS5098565.145195560IPR005202Transcription factor GRAS
PfamPF035141.1E-132221581IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009863Biological Processsalicylic acid mediated signaling pathway
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0010187Biological Processnegative regulation of seed germination
GO:0010218Biological Processresponse to far red light
GO:0042176Biological Processregulation of protein catabolic process
GO:0042538Biological Processhyperosmotic salinity response
GO:2000033Biological Processregulation of seed dormancy process
GO:2000377Biological Processregulation of reactive oxygen species metabolic process
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 587 aa     Download sequence    Send to blast
MKRDHHQFQG RLSNHGTSSS SSSISKDKMM MVKKEEDGGG NMDDELLAVL GYKVRSSEMA  60
EVALKLEQLE TMMSNVQEDG LSHLATDTVH YNPSELYSWL DNMLSELNPP PLPASSNGLD  120
PVLPSPEICG FPASDYDLKV IPGNAIYQFP AIDSSSSSNN QNKRLKSCSS PDSMVTSTST  180
GTQIGGVIGT TVTTTTTTTT AAGESTRSVI LVDSQENGVR LVHALMACAE AIQQNNLTLA  240
EALVKQIGCL AVSQAGAMRK VATYFAEALA RRIYRLSPPQ NQIDHCLSDT LQMHFYETCP  300
YLKFAHFTAN QAILEAFEGK KRVHVIDFSM NQGLQWPALM QALALREGGP PTFRLTGIGP  360
PAPDNSDHLH EVGCKLAQLA EAIHVEFEYR GFVANSLADL DASMLELRPS DTEAVAVNSV  420
FELHKLLGRP GGIEKVLGVV KQIKPVIFTV VEQESNHNGP VFLDRFTESL HYYSTLFDSL  480
EGVPNSQDKV MSEVYLGKQI CNLVACEGPD RVERHETLSQ WGNRFGSSGL APAHLGSNAF  540
KQASMLLSVF NSGQGYRVEE SNGCLMLGWH TRPLITTSAW KLSTAAY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-552215814375GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.240120.0bud| floral meristem| flower| root| silique
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO306779370.0
Genevisible266331_at0.0
Expression AtlasAT2G01570-
AtGenExpressAT2G01570-
ATTED-IIAT2G01570-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Ubiquitously expressed. Expressed in roots, rosette leaves, bolting and mature stems, young and mature siliques, flower buds and influorescences. {ECO:0000269|PubMed:11877383, ECO:0000269|PubMed:20093430, ECO:0000269|PubMed:9237632, ECO:0000269|PubMed:9490740}.
Functional Description ? help Back to Top
Source Description
TAIRMember of the VHIID/DELLA regulatory family. Contains homopolymeric serine and threonine residues, a putative nuclear localization signal, leucine heptad repeats, and an LXXLL motif. Putative transcriptional regulator repressing the gibberellin response and integration of phytohormone signalling. DELLAs repress cell proliferation and expansion that drives plant growth. The protein undergoes degradation in response to GA via the 26S proteasome. RGA1 binds to PIF3 and inhibits its DNA binding activity and thus affects the expression of PIF3 regulated genes. RGA may be involved in reducing ROS accumulation in response to stress by up-regulating the transcription of superoxide dismutases. Represses GA-induced vegetative growth and floral initiation. Rapidly degraded in response to GA. Involved in fruit and flower development.
UniProtProbable transcriptional regulator that acts as a repressor of the gibberellin (GA) signaling pathway. Probably acts by participating in large multiprotein complexes that repress transcription of GA-inducible genes. Positively regulates XERICO expression in seeds. Upon GA application, it is degraded by the proteasome, allowing the GA signaling pathway. Compared to other DELLA proteins, it is the most sensitive to GA application. No effect of the BOI proteins on its stability. Its activity is probably regulated by other phytohormones such as auxin and ethylene, attenuation of auxin transport delaying its GA-induced degradation. {ECO:0000269|PubMed:11606551, ECO:0000269|PubMed:11606552, ECO:0000269|PubMed:12610625, ECO:0000269|PubMed:14615596, ECO:0000269|PubMed:14973286, ECO:0000269|PubMed:15128937, ECO:0000269|PubMed:16034591, ECO:0000269|PubMed:17933900, ECO:0000269|PubMed:20093430, ECO:0000269|PubMed:9490740}.
Function -- GeneRIF ? help Back to Top
  1. SLEEPY1 interacts directly with RGA and GA INSENSITIVE (GAI, a closely related DELLA protein) via their C-terminal GRAS domain
    [PMID: 15155881]
  2. SLY1 (the wild-type form) and sly1gar2-1 both confer substrate specificity on this complex via specific binding to the DELLA proteins, GAI and RGA
    [PMID: 15161962]
  3. We show that ga1-3 seeds lacking RGA, RGL1 and RGL2 or GAI, RGL1 and RGL2, confer GA-independent germination in the light but not in the darkness whilst ga1-3 seeds lacking GAI, RGA and RGL2 germinate both in the light and darkness.
    [PMID: 16034591]
  4. DELLA abundance is regulated during growth responses to neighbours in dense Arabidopsis stands. This occurs in a red:far red ratio-dependent manner in petioles, depends on gibberellin, and matches the induction kinetics of petiole elongation.
    [PMID: 17488236]
  5. Data show that cold/CBF1 enhances the accumulation of a green fluorescent protein (GFP)-tagged DELLA protein (GFP-RGA) by reducing GA content through stimulating expression of GA-inactivating GA 2-oxidase genes.
    [PMID: 18757556]
  6. We show that repression of germination by far-red light involves stabilized DELLA factors GAI, RGA and RGL2 that stimulate endogenous abscisic acid synthesis which, in turn, blocks germination through the transcription factor ABI3.
    [PMID: 19556968]
  7. Data documented that Lys-29 of ubiquitin is the major site for ubiquitin chain formation to mediate DELLA protein degradation that also required protein Ser/Thr dephosphorylation activity. The LZ domain is essential for both their stability and activity.
    [PMID: 19717618]
  8. SPT acts in an analogous manner to the gibberellin-dependent DELLAs, REPRESSOR OF GA1-3 and GIBBERELLIC ACID INSENSITIVE, which restrain cotyledon expansion alongside SPT.
    [PMID: 21478445]
  9. Studies indicate that GRAS proteins are named after the first three members: GIBBERELLIC ACID INSENSITIVE (GAI), REPRESSOR of GAI (RGA) and SCARECROW (SCR), and they have diverse roles in plant development and signal transduction.
    [PMID: 21732203]
  10. RGA represses flowering in leaves through FT and miR172 under long-day conditions, and represses flowering at the shoot apex through MADS box genes.
    [PMID: 22942378]
  11. Data indicate that BZR1 interacts in vitro and in vivo with REPRESSOR OF ga1-3 (RGA), a member of the DELLA family of transcriptional regulators that inhibits the gibberellins (GAs) signaling pathway.
    [PMID: 23033541]
  12. DELLA activity is essential for Arabidopsis pollen development.
    [PMID: 24400898]
  13. The six conserved Ser/Thr sites are important for the different bioactivities of the RGA protein that regulate the gibberellin (GA) response, and also for RGA stability via the mimicking of phosphorylation/de-phosphorylation.
    [PMID: 25056926]
  14. RGA and GAI play distinct roles in seed germination.
    [PMID: 25064446]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00611ChIP-seqSRX647776Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G01570.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Upstream Regulators) ? help Back to Top
Source Upstream Regulator (A: Activate/R: Repress)
ATRM AT2G20180 (A)
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source Target Gene (A: Activate/R: Repress)
ATRM AT1G04310(A), AT1G15550(R), AT1G70510(A), AT2G04240(A), AT2G22300(A), AT2G36270(A), AT2G41940(A), AT3G27920(A), AT3G30775(A), AT3G58070(A), AT3G62230(R), AT4G25420(R), AT5G22920(A), AT5G41315(A), AT5G49450(A), AT5G61420(R)
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDabscisic acid, ethylene, gibberellin
Interaction ? help Back to Top
Source Intact With
BioGRIDAT2G02070, AT2G02080, AT2G20180, AT2G43010, AT2G45160, AT2G45680, AT3G05690, AT3G16770, AT3G24650, AT3G27010, AT3G27920, AT3G45260, AT3G47620, AT3G60630, AT3G62090, AT4G04890, AT4G21750, AT4G36930, AT5G12840, AT5G03150, AT5G20730, AT5G37020, AT5G41315, AT5G47640, AT5G66730, AT5G67110, AT1G06040, AT1G08970, AT1G09530, AT1G03840, AT1G30330, AT1G32640, AT1G35560, AT1G50420, AT1G54830, AT1G58100, AT1G63650, AT1G69690, AT1G72010, AT1G75080
IntActSearch Q9SLH3
Phenotype -- Disruption Phenotype ? help Back to Top
Source Description
UniProtDISRUPTION PHENOTYPE: Rga, gai, rgl1, rgl2 and rgl3 pentuple mutant displays constitutive GA responses even in the absence of GA treatment. {ECO:0000269|PubMed:23482857}.
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G01570
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGQ1777210.0GQ177721.1 Arabidopsis thaliana ecotype Ei-2 RGA gene, complete sequence.
GenBankAC0055600.0AC005560.3 Arabidopsis thaliana chromosome 2 clone F2I9 map rga, complete sequence.
GenBankCP0026850.0CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence.
GenBankBT0104670.0BT010467.1 Arabidopsis thaliana At2g01570/F2I9.19 gene, complete cds.
GenBankAY0541600.0AY054160.1 Arabidopsis thaliana At2g01570/F2I9.19 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_178266.10.0DELLA protein RGA
SwissprotQ9SLH30.0RGA_ARATH; DELLA protein RGA
TrEMBLD7LLT10.0D7LLT1_ARALL; RGA1 protein
STRINGAT2G01570.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP12511550
MalvidsOGEM83728121
Publications ? help Back to Top
  1. Pysh LD,Wysocka-Diller JW,Camilleri C,Bouchez D,Benfey PN
    The GRAS gene family in Arabidopsis: sequence characterization and basic expression analysis of the SCARECROW-LIKE genes.
    Plant J., 1999. 18(1): p. 111-9
    [PMID:10341448]
  2. Vivian-Smith A,Koltunow AM
    Genetic analysis of growth-regulator-induced parthenocarpy in Arabidopsis.
    Plant Physiol., 1999. 121(2): p. 437-51
    [PMID:10517835]
  3. Ogawa M,Kusano T,Katsumi M,Sano H
    Rice gibberellin-insensitive gene homolog, OsGAI, encodes a nuclear-localized protein capable of gene activation at transcriptional level.
    Gene, 2000. 245(1): p. 21-9
    [PMID:10713441]
  4. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  5. Ikeda A, et al.
    slender rice, a constitutive gibberellin response mutant, is caused by a null mutation of the SLR1 gene, an ortholog of the height-regulating gene GAI/RGA/RHT/D8.
    Plant Cell, 2001. 13(5): p. 999-1010
    [PMID:11340177]
  6. Silverstone AL, et al.
    Repressing a repressor: gibberellin-induced rapid reduction of the RGA protein in Arabidopsis.
    Plant Cell, 2001. 13(7): p. 1555-66
    [PMID:11449051]
  7. King KE,Moritz T,Harberd NP
    Gibberellins are not required for normal stem growth in Arabidopsis thaliana in the absence of GAI and RGA.
    Genetics, 2001. 159(2): p. 767-76
    [PMID:11606551]
  8. Dill A,Sun T
    Synergistic derepression of gibberellin signaling by removing RGA and GAI function in Arabidopsis thaliana.
    Genetics, 2001. 159(2): p. 777-85
    [PMID:11606552]
  9. Dill A,Jung HS,Sun TP
    The DELLA motif is essential for gibberellin-induced degradation of RGA.
    Proc. Natl. Acad. Sci. U.S.A., 2001. 98(24): p. 14162-7
    [PMID:11717468]
  10. Wen CK,Chang C
    Arabidopsis RGL1 encodes a negative regulator of gibberellin responses.
    Plant Cell, 2002. 14(1): p. 87-100
    [PMID:11826301]
  11. Lee S, et al.
    Gibberellin regulates Arabidopsis seed germination via RGL2, a GAI/RGA-like gene whose expression is up-regulated following imbibition.
    Genes Dev., 2002. 16(5): p. 646-58
    [PMID:11877383]
  12. Chandler PM,Marion-Poll A,Ellis M,Gubler F
    Mutants at the Slender1 locus of barley cv Himalaya. Molecular and physiological characterization.
    Plant Physiol., 2002. 129(1): p. 181-90
    [PMID:12011349]
  13. Peng J,Harberd NP
    The role of GA-mediated signalling in the control of seed germination.
    Curr. Opin. Plant Biol., 2002. 5(5): p. 376-81
    [PMID:12183174]
  14. Fleck B,Harberd NP
    Evidence that the Arabidopsis nuclear gibberellin signalling protein GAI is not destabilised by gibberellin.
    Plant J., 2002. 32(6): p. 935-47
    [PMID:12492836]
  15. Fu X,Harberd NP
    Auxin promotes Arabidopsis root growth by modulating gibberellin response.
    Nature, 2003. 421(6924): p. 740-3
    [PMID:12610625]
  16. McGinnis KM, et al.
    The Arabidopsis SLEEPY1 gene encodes a putative F-box subunit of an SCF E3 ubiquitin ligase.
    Plant Cell, 2003. 15(5): p. 1120-30
    [PMID:12724538]
  17. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  18. Achard P,Vriezen WH,Van Der Straeten D,Harberd NP
    Ethylene regulates arabidopsis development via the modulation of DELLA protein growth repressor function.
    Plant Cell, 2003. 15(12): p. 2816-25
    [PMID:14615596]
  19. Muangprom A,Osborn TC
    Characterization of a dwarf gene in Brassica rapa, including the identification of a candidate gene.
    Theor. Appl. Genet., 2004. 108(7): p. 1378-84
    [PMID:14727029]
  20. Vriezen WH,Achard P,Harberd NP,Van Der Straeten D
    Ethylene-mediated enhancement of apical hook formation in etiolated Arabidopsis thaliana seedlings is gibberellin dependent.
    Plant J., 2004. 37(4): p. 505-16
    [PMID:14756759]
  21. Bolle C
    The role of GRAS proteins in plant signal transduction and development.
    Planta, 2004. 218(5): p. 683-92
    [PMID:14760535]
  22. Swain SM,Muller AJ,Singh DP
    The gar2 and rga alleles increase the growth of gibberellin-deficient pollen tubes in Arabidopsis.
    Plant Physiol., 2004. 134(2): p. 694-705
    [PMID:14764903]
  23. Alabad
    Gibberellins repress photomorphogenesis in darkness.
    Plant Physiol., 2004. 134(3): p. 1050-7
    [PMID:14963246]
  24. Cheng H, et al.
    Gibberellin regulates Arabidopsis floral development via suppression of DELLA protein function.
    Development, 2004. 131(5): p. 1055-64
    [PMID:14973286]
  25. Yu H, et al.
    Floral homeotic genes are targets of gibberellin signaling in flower development.
    Proc. Natl. Acad. Sci. U.S.A., 2004. 101(20): p. 7827-32
    [PMID:15128937]
  26. Dill A,Thomas SG,Hu J,Steber CM,Sun TP
    The Arabidopsis F-box protein SLEEPY1 targets gibberellin signaling repressors for gibberellin-induced degradation.
    Plant Cell, 2004. 16(6): p. 1392-405
    [PMID:15155881]
  27. Fu X, et al.
    The Arabidopsis mutant sleepy1gar2-1 protein promotes plant growth by increasing the affinity of the SCFSLY1 E3 ubiquitin ligase for DELLA protein substrates.
    Plant Cell, 2004. 16(6): p. 1406-18
    [PMID:15161962]
  28. Tyler L, et al.
    Della proteins and gibberellin-regulated seed germination and floral development in Arabidopsis.
    Plant Physiol., 2004. 135(2): p. 1008-19
    [PMID:15173565]
  29. Strader LC,Ritchie S,Soule JD,McGinnis KM,Steber CM
    Recessive-interfering mutations in the gibberellin signaling gene SLEEPY1 are rescued by overexpression of its homologue, SNEEZY.
    Proc. Natl. Acad. Sci. U.S.A., 2004. 101(34): p. 12771-6
    [PMID:15308775]
  30. Muangprom A,Thomas SG,Sun TP,Osborn TC
    A novel dwarfing mutation in a green revolution gene from Brassica rapa.
    Plant Physiol., 2005. 137(3): p. 931-8
    [PMID:15734906]
  31. Cao D,Hussain A,Cheng H,Peng J
    Loss of function of four DELLA genes leads to light- and gibberellin-independent seed germination in Arabidopsis.
    Planta, 2005. 223(1): p. 105-13
    [PMID:16034591]
  32. Brenner WG,Romanov GA,K
    Immediate-early and delayed cytokinin response genes of Arabidopsis thaliana identified by genome-wide expression profiling reveal novel cytokinin-sensitive processes and suggest cytokinin action through transcriptional cascades.
    Plant J., 2005. 44(2): p. 314-33
    [PMID:16212609]
  33. Achard P, et al.
    Integration of plant responses to environmentally activated phytohormonal signals.
    Science, 2006. 311(5757): p. 91-4
    [PMID:16400150]
  34. Busov V, et al.
    Transgenic modification of gai or rgl1 causes dwarfing and alters gibberellins, root growth, and metabolite profiles in Populus.
    Planta, 2006. 224(2): p. 288-99
    [PMID:16404575]
  35. Nakajima M, et al.
    Identification and characterization of Arabidopsis gibberellin receptors.
    Plant J., 2006. 46(5): p. 880-9
    [PMID:16709201]
  36. Penfield S,Gilday AD,Halliday KJ,Graham IA
    DELLA-mediated cotyledon expansion breaks coat-imposed seed dormancy.
    Curr. Biol., 2006. 16(23): p. 2366-70
    [PMID:17141619]
  37. Silverstone AL, et al.
    Functional analysis of SPINDLY in gibberellin signaling in Arabidopsis.
    Plant Physiol., 2007. 143(2): p. 987-1000
    [PMID:17142481]
  38. Griffiths J, et al.
    Genetic characterization and functional analysis of the GID1 gibberellin receptors in Arabidopsis.
    Plant Cell, 2006. 18(12): p. 3399-414
    [PMID:17194763]
  39. Willige BC, et al.
    The DELLA domain of GA INSENSITIVE mediates the interaction with the GA INSENSITIVE DWARF1A gibberellin receptor of Arabidopsis.
    Plant Cell, 2007. 19(4): p. 1209-20
    [PMID:17416730]
  40. Oh E, et al.
    PIL5, a phytochrome-interacting bHLH protein, regulates gibberellin responsiveness by binding directly to the GAI and RGA promoters in Arabidopsis seeds.
    Plant Cell, 2007. 19(4): p. 1192-208
    [PMID:17449805]
  41. Djakovic-Petrovic T,de Wit M,Voesenek LA,Pierik R
    DELLA protein function in growth responses to canopy signals.
    Plant J., 2007. 51(1): p. 117-26
    [PMID:17488236]
  42. Gan Y,Yu H,Peng J,Broun P
    Genetic and molecular regulation by DELLA proteins of trichome development in Arabidopsis.
    Plant Physiol., 2007. 145(3): p. 1031-42
    [PMID:17704233]
  43. Zentella R, et al.
    Global analysis of della direct targets in early gibberellin signaling in Arabidopsis.
    Plant Cell, 2007. 19(10): p. 3037-57
    [PMID:17933900]
  44. Vandenbussche F, et al.
    Ethylene-induced Arabidopsis hypocotyl elongation is dependent on but not mediated by gibberellins.
    J. Exp. Bot., 2007. 58(15-16): p. 4269-81
    [PMID:18182430]
  45. Feng S, et al.
    Coordinated regulation of Arabidopsis thaliana development by light and gibberellins.
    Nature, 2008. 451(7177): p. 475-9
    [PMID:18216856]
  46. de Lucas M, et al.
    A molecular framework for light and gibberellin control of cell elongation.
    Nature, 2008. 451(7177): p. 480-4
    [PMID:18216857]
  47. Bassel GW, et al.
    Elucidating the germination transcriptional program using small molecules.
    Plant Physiol., 2008. 147(1): p. 143-55
    [PMID:18359847]
  48. Desgagn
    Expression of gibberellin 20-oxidase1 (AtGA20ox1) in Arabidopsis seedlings with altered auxin status is regulated at multiple levels.
    J. Exp. Bot., 2008. 59(8): p. 2057-70
    [PMID:18440929]
  49. Achard P,Renou JP,Berthomé R,Harberd NP,Genschik P
    Plant DELLAs restrain growth and promote survival of adversity by reducing the levels of reactive oxygen species.
    Curr. Biol., 2008. 18(9): p. 656-60
    [PMID:18450450]
  50. Navarro L, et al.
    DELLAs control plant immune responses by modulating the balance of jasmonic acid and salicylic acid signaling.
    Curr. Biol., 2008. 18(9): p. 650-5
    [PMID:18450451]
  51. Kim DH, et al.
    SOMNUS, a CCCH-type zinc finger protein in Arabidopsis, negatively regulates light-dependent seed germination downstream of PIL5.
    Plant Cell, 2008. 20(5): p. 1260-77
    [PMID:18487351]
  52. Hou X, et al.
    Global identification of DELLA target genes during Arabidopsis flower development.
    Plant Physiol., 2008. 147(3): p. 1126-42
    [PMID:18502975]
  53. Sawada Y, et al.
    Germination of photoblastic lettuce seeds is regulated via the control of endogenous physiologically active gibberellin content, rather than of gibberellin responsiveness.
    J. Exp. Bot., 2008. 59(12): p. 3383-93
    [PMID:18653696]
  54. Achard P, et al.
    The cold-inducible CBF1 factor-dependent signaling pathway modulates the accumulation of the growth-repressing DELLA proteins via its effect on gibberellin metabolism.
    Plant Cell, 2008. 20(8): p. 2117-29
    [PMID:18757556]
  55. Ariizumi T,Murase K,Sun TP,Steber CM
    Proteolysis-independent downregulation of DELLA repression in Arabidopsis by the gibberellin receptor GIBBERELLIN INSENSITIVE DWARF1.
    Plant Cell, 2008. 20(9): p. 2447-59
    [PMID:18827182]
  56. Piskurewicz U, et al.
    The gibberellic acid signaling repressor RGL2 inhibits Arabidopsis seed germination by stimulating abscisic acid synthesis and ABI5 activity.
    Plant Cell, 2008. 20(10): p. 2729-45
    [PMID:18941053]
  57. Maymon I, et al.
    Cytosolic activity of SPINDLY implies the existence of a DELLA-independent gibberellin-response pathway.
    Plant J., 2009. 58(6): p. 979-88
    [PMID:19228341]
  58. Oh E, et al.
    Genome-wide analysis of genes targeted by PHYTOCHROME INTERACTING FACTOR 3-LIKE5 during seed germination in Arabidopsis.
    Plant Cell, 2009. 21(2): p. 403-19
    [PMID:19244139]
  59. Cheng H, et al.
    Gibberellin acts through jasmonate to control the expression of MYB21, MYB24, and MYB57 to promote stamen filament growth in Arabidopsis.
    PLoS Genet., 2009. 5(3): p. e1000440
    [PMID:19325888]
  60. Geraldo N,B
    FRIGIDA delays flowering in Arabidopsis via a cotranscriptional mechanism involving direct interaction with the nuclear cap-binding complex.
    Plant Physiol., 2009. 150(3): p. 1611-8
    [PMID:19429606]
  61. Suzuki H, et al.
    Differential expression and affinities of Arabidopsis gibberellin receptors can explain variation in phenotypes of multiple knock-out mutants.
    Plant J., 2009. 60(1): p. 48-55
    [PMID:19500306]
  62. Piskurewicz U,Turecková V,Lacombe E,Lopez-Molina L
    Far-red light inhibits germination through DELLA-dependent stimulation of ABA synthesis and ABI3 activity.
    EMBO J., 2009. 28(15): p. 2259-71
    [PMID:19556968]
  63. Ubeda-Tom
    Gibberellin signaling in the endodermis controls Arabidopsis root meristem size.
    Curr. Biol., 2009. 19(14): p. 1194-9
    [PMID:19576770]
  64. Stavang JA, et al.
    Hormonal regulation of temperature-induced growth in Arabidopsis.
    Plant J., 2009. 60(4): p. 589-601
    [PMID:19686536]
  65. Wang F, et al.
    Biochemical insights on degradation of Arabidopsis DELLA proteins gained from a cell-free assay system.
    Plant Cell, 2009. 21(8): p. 2378-90
    [PMID:19717618]
  66. Dohmann EM,Nill C,Schwechheimer C
    DELLA proteins restrain germination and elongation growth in Arabidopsis thaliana COP9 signalosome mutants.
    Eur. J. Cell Biol., 2010 Feb-Mar. 89(2-3): p. 163-8
    [PMID:20083325]
  67. Gallego-Bartolomé J, et al.
    Transcriptional diversification and functional conservation between DELLA proteins in Arabidopsis.
    Mol. Biol. Evol., 2010. 27(6): p. 1247-56
    [PMID:20093430]
  68. Isono E, et al.
    The deubiquitinating enzyme AMSH3 is required for intracellular trafficking and vacuole biogenesis in Arabidopsis thaliana.
    Plant Cell, 2010. 22(6): p. 1826-37
    [PMID:20543027]
  69. Moubayidin L, et al.
    The rate of cell differentiation controls the Arabidopsis root meristem growth phase.
    Curr. Biol., 2010. 20(12): p. 1138-43
    [PMID:20605455]
  70. Wang L,Mai YX,Zhang YC,Luo Q,Yang HQ
    MicroRNA171c-targeted SCL6-II, SCL6-III, and SCL6-IV genes regulate shoot branching in Arabidopsis.
    Mol Plant, 2010. 3(5): p. 794-806
    [PMID:20720155]
  71. Arnaud N, et al.
    Gibberellins control fruit patterning in Arabidopsis thaliana.
    Genes Dev., 2010. 24(19): p. 2127-32
    [PMID:20889713]
  72. Shin R,Jez JM,Basra A,Zhang B,Schachtman DP
    14-3-3 proteins fine-tune plant nutrient metabolism.
    FEBS Lett., 2011. 585(1): p. 143-7
    [PMID:21094157]
  73. Hou X,Lee LY,Xia K,Yan Y,Yu H
    DELLAs modulate jasmonate signaling via competitive binding to JAZs.
    Dev. Cell, 2010. 19(6): p. 884-94
    [PMID:21145503]
  74. Ariizumi T,Lawrence PK,Steber CM
    The role of two f-box proteins, SLEEPY1 and SNEEZY, in Arabidopsis gibberellin signaling.
    Plant Physiol., 2011. 155(2): p. 765-75
    [PMID:21163960]
  75. Tamura K,Fukao Y,Iwamoto M,Haraguchi T,Hara-Nishimura I
    Identification and characterization of nuclear pore complex components in Arabidopsis thaliana.
    Plant Cell, 2010. 22(12): p. 4084-97
    [PMID:21189294]
  76. Zhang ZL, et al.
    Scarecrow-like 3 promotes gibberellin signaling by antagonizing master growth repressor DELLA in Arabidopsis.
    Proc. Natl. Acad. Sci. U.S.A., 2011. 108(5): p. 2160-5
    [PMID:21245327]
  77. Lalonde S, et al.
    A membrane protein/signaling protein interaction network for Arabidopsis version AMPv2.
    Front Physiol, 2010. 1: p. 24
    [PMID:21423366]
  78. Ariizumi T,Steber CM
    Mutations in the F-box gene SNEEZY result in decreased Arabidopsis GA signaling.
    Plant Signal Behav, 2011. 6(6): p. 831-3
    [PMID:21455025]
  79. Josse EM, et al.
    A DELLA in disguise: SPATULA restrains the growth of the developing Arabidopsis seedling.
    Plant Cell, 2011. 23(4): p. 1337-51
    [PMID:21478445]
  80. Feurtado JA, et al.
    The Arabidopsis C2H2 zinc finger INDETERMINATE DOMAIN1/ENHYDROUS promotes the transition to germination by regulating light and hormonal signaling during seed maturation.
    Plant Cell, 2011. 23(5): p. 1772-94
    [PMID:21571950]
  81. Gao Y,Chen J,Zhao Y,Li T,Wang M
    Molecular cloning and expression analysis of a RGA-like gene responsive to plant hormones in Brassica napus.
    Mol. Biol. Rep., 2012. 39(2): p. 1957-62
    [PMID:21643957]
  82. Sun X, et al.
    A functionally required unfoldome from the plant kingdom: intrinsically disordered N-terminal domains of GRAS proteins are involved in molecular recognition during plant development.
    Plant Mol. Biol., 2011. 77(3): p. 205-23
    [PMID:21732203]
  83. Arabidopsis Interactome Mapping Consortium
    Evidence for network evolution in an Arabidopsis interactome map.
    Science, 2011. 333(6042): p. 601-7
    [PMID:21798944]
  84. Gallego-Bartolom
    DELLA-induced early transcriptional changes during etiolated development in Arabidopsis thaliana.
    PLoS ONE, 2011. 6(8): p. e23918
    [PMID:21904598]
  85. Gaudinier A, et al.
    Enhanced Y1H assays for Arabidopsis.
    Nat. Methods, 2011. 8(12): p. 1053-5
    [PMID:22037706]
  86. Footitt S,Douterelo-Soler I,Clay H,Finch-Savage WE
    Dormancy cycling in Arabidopsis seeds is controlled by seasonally distinct hormone-signaling pathways.
    Proc. Natl. Acad. Sci. U.S.A., 2011. 108(50): p. 20236-41
    [PMID:22128331]
  87. Lee LY, et al.
    STUNTED mediates the control of cell proliferation by GA in Arabidopsis.
    Development, 2012. 139(9): p. 1568-76
    [PMID:22492352]
  88. Yang DL, et al.
    Plant hormone jasmonate prioritizes defense over growth by interfering with gibberellin signaling cascade.
    Proc. Natl. Acad. Sci. U.S.A., 2012. 109(19): p. E1192-200
    [PMID:22529386]
  89. Hong GJ,Xue XY,Mao YB,Wang LJ,Chen XY
    Arabidopsis MYC2 interacts with DELLA proteins in regulating sesquiterpene synthase gene expression.
    Plant Cell, 2012. 24(6): p. 2635-48
    [PMID:22669881]
  90. Bai MY, et al.
    Brassinosteroid, gibberellin and phytochrome impinge on a common transcription module in Arabidopsis.
    Nat. Cell Biol., 2012. 14(8): p. 810-7
    [PMID:22820377]
  91. Yu S, et al.
    Gibberellin regulates the Arabidopsis floral transition through miR156-targeted SQUAMOSA promoter binding-like transcription factors.
    Plant Cell, 2012. 24(8): p. 3320-32
    [PMID:22942378]
  92. Lee KP, et al.
    Spatially and genetically distinct control of seed germination by phytochromes A and B.
    Genes Dev., 2012. 26(17): p. 1984-96
    [PMID:22948663]
  93. Li QF, et al.
    An interaction between BZR1 and DELLAs mediates direct signaling crosstalk between brassinosteroids and gibberellins in Arabidopsis.
    Sci Signal, 2012. 5(244): p. ra72
    [PMID:23033541]
  94. Sun S, et al.
    GASA14 regulates leaf expansion and abiotic stress resistance by modulating reactive oxygen species accumulation.
    J. Exp. Bot., 2013. 64(6): p. 1637-47
    [PMID:23378382]
  95. Park J,Nguyen KT,Park E,Jeon JS,Choi G
    DELLA proteins and their interacting RING Finger proteins repress gibberellin responses by binding to the promoters of a subset of gibberellin-responsive genes in Arabidopsis.
    Plant Cell, 2013. 25(3): p. 927-43
    [PMID:23482857]
  96. Vaistij FE, et al.
    Differential control of seed primary dormancy in Arabidopsis ecotypes by the transcription factor SPATULA.
    Proc. Natl. Acad. Sci. U.S.A., 2013. 110(26): p. 10866-71
    [PMID:23754415]
  97. Sarnowska EA, et al.
    DELLA-interacting SWI3C core subunit of switch/sucrose nonfermenting chromatin remodeling complex modulates gibberellin responses and hormonal cross talk in Arabidopsis.
    Plant Physiol., 2013. 163(1): p. 305-17
    [PMID:23893173]
  98. Luo J, et al.
    A DELLA gene, RhGAI1, is a direct target of EIN3 and mediates ethylene-regulated rose petal cell expansion via repressing the expression of RhCesA2.
    J. Exp. Bot., 2013. 64(16): p. 5075-84
    [PMID:24014864]
  99. Lim S, et al.
    ABA-insensitive3, ABA-insensitive5, and DELLAs Interact to activate the expression of SOMNUS and other high-temperature-inducible genes in imbibed seeds in Arabidopsis.
    Plant Cell, 2013. 25(12): p. 4863-78
    [PMID:24326588]
  100. Plackett AR, et al.
    DELLA activity is required for successful pollen development in the Columbia ecotype of Arabidopsis.
    New Phytol., 2014. 201(3): p. 825-36
    [PMID:24400898]
  101. Conti L, et al.
    Small Ubiquitin-like Modifier protein SUMO enables plants to control growth independently of the phytohormone gibberellin.
    Dev. Cell, 2014. 28(1): p. 102-10
    [PMID:24434138]
  102. Qi T, et al.
    Arabidopsis DELLA and JAZ proteins bind the WD-repeat/bHLH/MYB complex to modulate gibberellin and jasmonate signaling synergy.
    Plant Cell, 2014. 26(3): p. 1118-33
    [PMID:24659329]
  103. Yoshida H, et al.
    DELLA protein functions as a transcriptional activator through the DNA binding of the indeterminate domain family proteins.
    Proc. Natl. Acad. Sci. U.S.A., 2014. 111(21): p. 7861-6
    [PMID:24821766]
  104. Rombol
    Arabidopsis DELLA and two HD-ZIP transcription factors regulate GA signaling in the epidermis through the L1 box cis-element.
    Plant Cell, 2014. 26(7): p. 2905-19
    [PMID:24989044]
  105. Qin Q, et al.
    Arabidopsis DELLA protein degradation is controlled by a type-one protein phosphatase, TOPP4.
    PLoS Genet., 2014. 10(7): p. e1004464
    [PMID:25010794]
  106. Wang W, et al.
    The six conserved serine/threonine sites of REPRESSOR OF ga1-3 protein are important for its functionality and stability in gibberellin signaling in Arabidopsis.
    Planta, 2014. 240(4): p. 763-79
    [PMID:25056926]
  107. Boccaccini A, et al.
    Independent and interactive effects of DOF affecting germination 1 (DAG1) and the Della proteins GA insensitive (GAI) and Repressor of ga1-3 (RGA) in embryo development and seed germination.
    BMC Plant Biol., 2014. 14: p. 200
    [PMID:25064446]
  108. Ma Z, et al.
    Arabidopsis miR171-targeted scarecrow-like proteins bind to GT cis-elements and mediate gibberellin-regulated chlorophyll biosynthesis under light conditions.
    PLoS Genet., 2014. 10(8): p. e1004519
    [PMID:25101599]
  109. Hou X, et al.
    Nuclear factor Y-mediated H3K27me3 demethylation of the SOC1 locus orchestrates flowering responses of Arabidopsis.
    Nat Commun, 2014. 5: p. 4601
    [PMID:25105952]
  110. Mar
    Large-scale identification of gibberellin-related transcription factors defines group VII ETHYLENE RESPONSE FACTORS as functional DELLA partners.
    Plant Physiol., 2014. 166(2): p. 1022-32
    [PMID:25118255]
  111. Davi
    Class I TCP-DELLA interactions in inflorescence shoot apex determine plant height.
    Curr. Biol., 2014. 24(16): p. 1923-8
    [PMID:25127215]
  112. Crocco CD, et al.
    The transcriptional regulator BBX24 impairs DELLA activity to promote shade avoidance in Arabidopsis thaliana.
    Nat Commun, 2015. 6: p. 6202
    [PMID:25656233]
  113. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]
  114. Nelis S,Conti L,Zhang C,Sadanandom A
    A functional Small Ubiquitin-like Modifier (SUMO) interacting motif (SIM) in the gibberellin hormone receptor GID1 is conserved in cereal crops and disrupting this motif does not abolish hormone dependency of the DELLA-GID1 interaction.
    Plant Signal Behav, 2015. 10(2): p. e987528
    [PMID:25761145]
  115. Silverstone AL,Mak PY,Martínez EC,Sun TP
    The new RGA locus encodes a negative regulator of gibberellin response in Arabidopsis thaliana.
    Genetics, 1997. 146(3): p. 1087-99
    [PMID:9215910]
  116. Truong HN,Caboche M,Daniel-Vedele F
    Sequence and characterization of two Arabidopsis thaliana cDNAs isolated by functional complementation of a yeast gln3 gdh1 mutant.
    FEBS Lett., 1997. 410(2-3): p. 213-8
    [PMID:9237632]
  117. Peng J, et al.
    The Arabidopsis GAI gene defines a signaling pathway that negatively regulates gibberellin responses.
    Genes Dev., 1997. 11(23): p. 3194-205
    [PMID:9389651]
  118. Silverstone AL,Ciampaglio CN,Sun T
    The Arabidopsis RGA gene encodes a transcriptional regulator repressing the gibberellin signal transduction pathway.
    Plant Cell, 1998. 10(2): p. 155-69
    [PMID:9490740]