PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G01500.1
Common NameF2I9.12, HOS9, PFS2, WOX6
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family WOX
Protein Properties Length: 271aa    MW: 31452.8 Da    PI: 7.0632
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G01500.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox67.91.3e-2161118456
                  -SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHH CS
     Homeobox   4 RttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakek 56 
                  R+++t+eq+++Leel+++ +r+p++e+++++A+kl    +++ ++V++WFqN++a+e+
  AT2G01500.1  61 RWNPTPEQITTLEELYRSgTRTPTTEQIQQIASKLrkygRIEGKNVFYWFQNHKARER 118
                  *****************99*************************************98 PP

2Wus_type_Homeobox113.79.4e-3759120364
  Wus_type_Homeobox   3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64 
                        + RW+PtpeQi+ Leely+sG+rtP++e+iq+i+++L++yG+ie+kNVfyWFQN+kaRer k
        AT2G01500.1  59 TLRWNPTPEQITTLEELYRSGTRTPTTEQIQQIASKLRKYGRIEGKNVFYWFQNHKARERLK 120
                        67**********************************************************88 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003891.9E-557124IPR001356Homeobox domain
SuperFamilySSF466893.81E-1259119IPR009057Homeodomain-like
CDDcd000868.32E-561115No hitNo description
PfamPF000463.0E-1961118IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.6E-861118IPR009057Homeodomain-like
PROSITE profilePS5007111.20865120IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009409Biological Processresponse to cold
GO:0009965Biological Processleaf morphogenesis
GO:0016049Biological Processcell growth
GO:0030154Biological Processcell differentiation
GO:0048314Biological Processembryo sac morphogenesis
GO:0048446Biological Processpetal morphogenesis
GO:0048482Biological Processplant ovule morphogenesis
GO:0051301Biological Processcell division
GO:0048353Cellular Componentprimary endosperm nucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000005anatomycultured plant cell
PO:0000229anatomyflower meristem
PO:0009009anatomyplant embryo
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009049anatomyinflorescence
PO:0009062anatomygynoecium
PO:0009071anatomyanther wall tapetum
PO:0020003anatomyplant ovule
PO:0020108anatomysuspensor
Sequence ? help Back to Top
Protein Sequence    Length: 271 aa     Download sequence    Send to blast
MGYISNNNLI NYLPLSTTQP PLLLTHCDIN GNDHHQLITA SSGEHDIDER KNNIPAAATL  60
RWNPTPEQIT TLEELYRSGT RTPTTEQIQQ IASKLRKYGR IEGKNVFYWF QNHKARERLK  120
RRRREGGAII KPHKDVKDSS SGGHRVDQTK LCPSFPHTNR PQPQHELDPA SYNKDNNANN  180
EDHGTTEESD QRASEVGKYA TWRNLVTWSI TQQPEEINID ENVNGEEEET RDNRTLNLFP  240
VREYQEKTGR LIEKTKACNY CYYYEFMPLK N
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible266354_at0.0
Expression AtlasAT2G01500-
AtGenExpressAT2G01500-
ATTED-IIAT2G01500-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: In developing seeds, it is expressed in the embryo, suspensor and endosperm nuclei, but absent in the integuments. In seedlings, it is expressed in the shoot apical meristem and leaf primordia, but not in expanded cotyledons or mature leaves. In reproductive structures, transcripts could be detected in floral apical meristems, floral primordia, stamens and pistils. Also expressed in the tapetum in anthers and in the gynoecium. Weakly expressed in petals, sepals and the walls of carpels. {ECO:0000269|PubMed:15659481}.
UniprotTISSUE SPECIFICITY: Highly expressed in developing ovules. Present in developing primordia and differentiating organs but absent in mature organs. {ECO:0000269|PubMed:15659481}.
Functional Description ? help Back to Top
Source Description
TAIRPFS2 encodes a homeodomain gene that is a member of the WUS clade of transcription factors. It delays differentiation and maturation of primordia and regulates ovule patterning. The pfs2 mutant exhibits developmental defects in the maternal integuments and gametophyte, specifically, the boundary between the chalaza and the nucellus shifted towards the distal end of pfs2 ovule primordia. In addition, leaves displayed curling and petals were wavy and crenulated. Overexpression of PFS2 affects floral organ and leaf development. Single- and double-mutant analyses reveal that PFS2 activity represses AGAMOUS expression in young floral primordia. Also involved in regulation of response to low temperature.
UniProtTranscription factor that plays a central role in ovule patterning by regulating cell proliferation of the maternal integuments and differentiation of the maegaspore mother cell (MCC). Involved in AGAMOUS (AG) repression in leaves. {ECO:0000269|PubMed:15659481}.
Function -- GeneRIF ? help Back to Top
  1. PRETTY FEW SEEDS2 gene encodes a homeodomain transcription factor which affects either ovule patterning or differentiation
    [PMID: 15659481]
  2. Genetic interaction of the ER family and the WOX-family gene, PFS2, reveals their contribution to integument development through interrelated mechanisms.
    [PMID: 17652352]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G01500.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source Target Gene (A: Activate/R: Repress)
ATRM AT4G18960(R)
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G01500
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ4464510.0DQ446451.1 Arabidopsis thaliana clone pENTR221-At2g01500 homeobox-leucine zipper transcription factor family protein (At2g01500) mRNA, complete cds.
GenBankAY8852220.0AY885222.1 Arabidopsis thaliana pretty few seeds 2 (PFS2) mRNA, complete cds.
GenBankAY2513990.0AY251399.2 Arabidopsis thaliana WOX6 protein mRNA, complete cds.
GenBankAY0858320.0AY085832.1 Arabidopsis thaliana clone 18820 mRNA, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_565263.10.0homeodomain transcription factor PFS2
SwissprotQ9ZVF50.0WOX6_ARATH; WUSCHEL-related homeobox 6
TrEMBLQ1PFB20.0Q1PFB2_ARATH; Homeobox-leucine zipper transcription factor family protein
TrEMBLA0MEH40.0A0MEH4_ARATH; Putative uncharacterized protein (Fragment)
STRINGAT2G01500.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM133691828
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. R
    Rapid identification of Arabidopsis insertion mutants by non-radioactive detection of T-DNA tagged genes.
    Plant J., 2002. 32(2): p. 243-53
    [PMID:12383089]
  3. Haecker A, et al.
    Expression dynamics of WOX genes mark cell fate decisions during early embryonic patterning in Arabidopsis thaliana.
    Development, 2004. 131(3): p. 657-68
    [PMID:14711878]
  4. Park SO,Hwang S,Hauser BA
    The phenotype of Arabidopsis ovule mutants mimics the morphology of primitive seed plants.
    Proc. Biol. Sci., 2004. 271(1536): p. 311-6
    [PMID:15058443]
  5. Zhu J, et al.
    An Arabidopsis homeodomain transcription factor gene, HOS9, mediates cold tolerance through a CBF-independent pathway.
    Proc. Natl. Acad. Sci. U.S.A., 2004. 101(26): p. 9873-8
    [PMID:15205481]
  6. Park SO,Zheng Z,Oppenheimer DG,Hauser BA
    The PRETTY FEW SEEDS2 gene encodes an Arabidopsis homeodomain protein that regulates ovule development.
    Development, 2005. 132(4): p. 841-9
    [PMID:15659481]
  7. Cai X, et al.
    A putative CCAAT-binding transcription factor is a regulator of flowering timing in Arabidopsis.
    Plant Physiol., 2007. 145(1): p. 98-105
    [PMID:17631525]
  8. Pillitteri LJ,Bemis SM,Shpak ED,Torii KU
    Haploinsufficiency after successive loss of signaling reveals a role for ERECTA-family genes in Arabidopsis ovule development.
    Development, 2007. 134(17): p. 3099-109
    [PMID:17652352]
  9. Wu X,Chory J,Weigel D
    Combinations of WOX activities regulate tissue proliferation during Arabidopsis embryonic development.
    Dev. Biol., 2007. 309(2): p. 306-16
    [PMID:17706632]
  10. Johnston AJ, et al.
    Genetic subtraction profiling identifies genes essential for Arabidopsis reproduction and reveals interaction between the female gametophyte and the maternal sporophyte.
    Genome Biol., 2007. 8(10): p. R204
    [PMID:17915010]
  11. Skinner DJ,Gasser CS
    Expression-based discovery of candidate ovule development regulators through transcriptional profiling of ovule mutants.
    BMC Plant Biol., 2009. 9: p. 29
    [PMID:19291320]
  12. Hirakawa Y,Kondo Y,Fukuda H
    TDIF peptide signaling regulates vascular stem cell proliferation via the WOX4 homeobox gene in Arabidopsis.
    Plant Cell, 2010. 22(8): p. 2618-29
    [PMID:20729381]
  13. Zhang X,Zong J,Liu J,Yin J,Zhang D
    Genome-wide analysis of WOX gene family in rice, sorghum, maize, Arabidopsis and poplar.
    J Integr Plant Biol, 2010. 52(11): p. 1016-26
    [PMID:20977659]
  14. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]