PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G01430.1
Common NameATHB17, ATHB-17, F2I9.5, HB17
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family HD-ZIP
Protein Properties Length: 275aa    MW: 31689.5 Da    PI: 9.481
Description homeobox-leucine zipper protein 17
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G01430.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.35.5e-18138192256
                  T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
     Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                  rk+ ++t+eq + Le+ F++n++++ +++e LAk+l L  rq+ vWFqNrRa+ k
  AT2G01430.1 138 RKKLRLTREQSRLLEDSFRQNHTLNPKQKEVLAKHLMLRPRQIEVWFQNRRARSK 192
                  78889************************************************98 PP

2HD-ZIP_I/II117.57.7e-38138226189
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLre 89 
                  +kk+rl++eq++lLE+sF+++++L+p++K+ la++L l+prq++vWFqnrRAR k+kq+E+++e+Lkr++ +l+een+rL++eveeLr+
  AT2G01430.1 138 RKKLRLTREQSRLLEDSFRQNHTLNPKQKEVLAKHLMLRPRQIEVWFQNRRARSKLKQTEMECEYLKRWFGSLTEENHRLHREVEELRA 226
                  69*************************************************************************************94 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.7E-17119192IPR009057Homeodomain-like
SuperFamilySSF466891.71E-18124195IPR009057Homeodomain-like
PROSITE profilePS5007116.941134194IPR001356Homeobox domain
SMARTSM003895.7E-17136198IPR001356Homeobox domain
CDDcd000865.33E-16137195No hitNo description
PfamPF000462.8E-15138192IPR001356Homeobox domain
PROSITE patternPS000270169192IPR017970Homeobox, conserved site
SMARTSM003404.5E-23194237IPR003106Leucine zipper, homeobox-associated
PfamPF021837.5E-10194228IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 275 aa     Download sequence    Send to blast
MIKLLFTYIC TYTYKLYALY HMDYACVCMY KYKGIVTLQV CLFYIKLRVF LSNFTFSSSI  60
LALKNPNNSL IKIMAILPEN SSNLDLTISV PGFSSSPLSD EGSGGGRDQL RLDMNRLPSS  120
EDGDDEEFSH DDGSAPPRKK LRLTREQSRL LEDSFRQNHT LNPKQKEVLA KHLMLRPRQI  180
EVWFQNRRAR SKLKQTEMEC EYLKRWFGSL TEENHRLHRE VEELRAMKVG PTTVNSASSL  240
TMCPRCERVT PAASPSRAVV PVPAKKTFPP QERDR
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1186194RRARSKLKQ
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible266346_at0.0
Expression AtlasAT2G01430-
AtGenExpressAT2G01430-
ATTED-IIAT2G01430-
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Function -- GeneRIF ? help Back to Top
  1. Results show that ATHB17 is involved in abscisic acid ABA and water-stress responses. Also, the ATHB17 effect on seedling growth in the presence of ABA was observed only during the postgermination seedling.
    [PMID: 23456334]
  2. This study reports the results of a functional genomics research effort that identified ATHB17, a transcription factor from the homeodomain-leucine zipper class II family, as a novel target for the enhancement of photosynthetic capacity.
    [PMID: 24006420]
  3. Expression of ATHB17Delta113 in maize leads to increased ear size at silking
    [PMID: 24736658]
  4. ATHB17 can positively modulate the expression of many plastid encoded genes (PEGs) through regulation of ATSIG5 by binding to their promoters.
    [PMID: 28358040]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G01430.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
BioGRIDAT2G01430
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G01430
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ4311810.0AJ431181.1 Arabidopsis thaliana mRNA for homeodomain-leucine zipper (Athb17 gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_178252.20.0homeobox-leucine zipper protein 17
SwissprotQ8S9N60.0ATB17_ARATH; Homeobox-leucine zipper protein ATHB-17
TrEMBLA0A178VTG11e-142A0A178VTG1_ARATH; HB17
STRINGAT2G01430.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM48902747
Representative plantOGRP19616156
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Oh S,Park S,Han KH
    Transcriptional regulation of secondary growth in Arabidopsis thaliana.
    J. Exp. Bot., 2003. 54(393): p. 2709-22
    [PMID:14585825]
  3. Guan Y,Nothnagel EA
    Binding of arabinogalactan proteins by Yariv phenylglycoside triggers wound-like responses in Arabidopsis cell cultures.
    Plant Physiol., 2004. 135(3): p. 1346-66
    [PMID:15235117]
  4. Lall S,Nettleton D,DeCook R,Che P,Howell SH
    Quantitative trait loci associated with adventitious shoot formation in tissue culture and the program of shoot development in Arabidopsis.
    Genetics, 2004. 167(4): p. 1883-92
    [PMID:15342526]
  5. Nawy T, et al.
    Transcriptional profile of the Arabidopsis root quiescent center.
    Plant Cell, 2005. 17(7): p. 1908-25
    [PMID:15937229]
  6. Henriksson E, et al.
    Homeodomain leucine zipper class I genes in Arabidopsis. Expression patterns and phylogenetic relationships.
    Plant Physiol., 2005. 139(1): p. 509-18
    [PMID:16055682]
  7. Fleury D, et al.
    The Arabidopsis thaliana homolog of yeast BRE1 has a function in cell cycle regulation during early leaf and root growth.
    Plant Cell, 2007. 19(2): p. 417-32
    [PMID:17329565]
  8. Park MY,Kim SA,Lee SJ,Kim SY
    ATHB17 is a positive regulator of abscisic acid response during early seedling growth.
    Mol. Cells, 2013. 35(2): p. 125-33
    [PMID:23456334]
  9. Hymus GJ, et al.
    Application of HB17, an Arabidopsis class II homeodomain-leucine zipper transcription factor, to regulate chloroplast number and photosynthetic capacity.
    J. Exp. Bot., 2013. 64(14): p. 4479-90
    [PMID:24006420]
  10. Rice EA, et al.
    Expression of a truncated ATHB17 protein in maize increases ear weight at silking.
    PLoS ONE, 2014. 9(4): p. e94238
    [PMID:24736658]
  11. Zhao P, et al.
    ATHB17 enhances stress tolerance by coordinating photosynthesis associated nuclear gene and ATSIG5 expression in response to abiotic stress.
    Sci Rep, 2017. 7: p. 45492
    [PMID:28358040]