PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G01370.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family GeBP
Protein Properties Length: 252aa    MW: 29436.6 Da    PI: 9.675
Description DNA-binding storekeeper protein-related transcriptional regulator
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G01370.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573127.84.7e-4079172297
       DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiWg 97 
                  +fqr+ws++DeivlLqG++df++++gksp+dd+++f+++vk+ isf+++++q+++KirrLK+Kf kk+++    +e+s+ ++hd+k+f+lsk iW+
  AT2G01370.1  79 YFQRIWSDDDEIVLLQGMVDFENDKGKSPYDDMTGFIDTVKNFISFQANQHQFTTKIRRLKDKFLKKWNN--GVDENSLVNAHDRKCFQLSKVIWE 172
                  8*********************************************************************..999********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045041.2E-2980172IPR007592Protein of unknown function DUF573
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 252 aa     Download sequence    Send to blast
MKGITKKLLV SRSLKRLTAK KNRRKIHRET NKRLKPEEDP SMVKRRQDSD SDSLEKEVSV  60
VVTKTSDDEM VSTDTKKNYF QRIWSDDDEI VLLQGMVDFE NDKGKSPYDD MTGFIDTVKN  120
FISFQANQHQ FTTKIRRLKD KFLKKWNNGV DENSLVNAHD RKCFQLSKVI WEPTTKVEEV  180
GDWFVNSYLV GSIARLGVSE DVMKQSWSMV PIETKKEVEE KFKLLKDEES ENLRLKTSFL  240
QKVNSMIIEA TN
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible260600_at2e-80
Expression AtlasAT2G01370-
AtGenExpressAT2G01370-
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G01370.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G01370
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0062000.0AC006200.3 Arabidopsis thaliana chromosome 2 clone F10A8 map rga, complete sequence.
GenBankCP0026850.0CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence.
GenBankAY6492470.0AY649247.1 Arabidopsis thaliana hypothetical protein (At2g01370) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_178246.10.0DNA-binding storekeeper protein-related transcriptional regulator
TrEMBLQ9ZU300.0Q9ZU30_ARATH; DNA-binding storekeeper protein-related transcriptional regulator
STRINGAT2G01370.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP4222523
MalvidsOGEM31328181
Publications ? help Back to Top
  1. Curaba J,Herzog M,Vachon G
    GeBP, the first member of a new gene family in Arabidopsis, encodes a nuclear protein with DNA-binding activity and is regulated by KNAT1.
    Plant J., 2003. 33(2): p. 305-17
    [PMID:12535344]