PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G79840.1
Common NameATHB10, F19K16.20, GL2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family HD-ZIP
Protein Properties Length: 747aa    MW: 83206.6 Da    PI: 6.4768
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G79840.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox665.2e-21102157156
                  TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
     Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                  r+k +++t++q++ +e+lF+++++p++++r++L+k+lgL  rqVk+WFqNrR++ k
  AT1G79840.1 102 RKKYHRHTTDQIRHMEALFKETPHPDEKQRQQLSKQLGLAPRQVKFWFQNRRTQIK 157
                  7999************************************************9877 PP

2START232.61.1e-722604862206
                  HHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS.......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEEEEE CS
        START   2 laeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv......dsgealrasgvvdmvlallveellddkeqWdetla....kaetlevi 85 
                  ++++a+ el+k+a+++ep+W +s+    e++n+de+l++f+++++      +++ea+r+ g+v+m++++l ++++d++ qW+et+a    ka+t++vi
  AT1G79840.1 260 ISNRATLELQKMATSGEPMWLRSVetgrEILNYDEYLKEFPQAQAssfpgrKTIEASRDAGIVFMDAHKLAQSFMDVG-QWKETFAclisKAATVDVI 356
                  7889999***********************************999*********************************.******************* PP

                  CTT.......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--..-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE--S CS
        START  86 ssg.......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe.sssvvRaellpSgiliepksnghskvtwvehvdlkg 174
                  ++g       ga+qlm+ e+q+l+p+vp R+++fvR++rql+ ++w+ivdvSv++e++++e ++s+ ++++lpSg++ie++snghskvtwveh d+++
  AT1G79840.1 357 RQGegpsridGAIQLMFGEMQLLTPVVPtREVYFVRSCRQLSPEKWAIVDVSVSVEDSNTEkEASLLKCRKLPSGCIIEDTSNGHSKVTWVEHLDVSA 454
                  ************************************************************************************************** PP

                  SXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
        START 175 rlphwllrslvksglaegaktwvatlqrqcek 206
                  ++++ l+rslv++gla+ga++wvatlq +ce+
  AT1G79840.1 455 STVQPLFRSLVNTGLAFGARHWVATLQLHCER 486
                  ******************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.2E-2288153IPR009057Homeodomain-like
SuperFamilySSF466895.43E-2093160IPR009057Homeodomain-like
PROSITE profilePS5007117.81599159IPR001356Homeobox domain
SMARTSM003899.6E-18101163IPR001356Homeobox domain
CDDcd000861.12E-17102157No hitNo description
PfamPF000462.6E-18102157IPR001356Homeobox domain
PROSITE patternPS000270134157IPR017970Homeobox, conserved site
PROSITE profilePS5084843.201250489IPR002913START domain
SuperFamilySSF559613.64E-30253486No hitNo description
CDDcd088755.49E-108254485No hitNo description
PfamPF018523.4E-67259486IPR002913START domain
SMARTSM002341.3E-83259486IPR002913START domain
Gene3DG3DSA:3.30.530.202.0E-7313485IPR023393START-like domain
SuperFamilySSF559612.27E-16515733No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009957Biological Processepidermal cell fate specification
GO:0010062Biological Processnegative regulation of trichoblast fate specification
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000026anatomyprimary root tip
PO:0000037anatomyshoot apex
PO:0000115anatomysocket cell
PO:0000263anatomynon-hair root epidermal cell
PO:0003015anatomyprimary root differentiation zone
PO:0006036anatomyroot epidermis
PO:0006504anatomyleaf trichome
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009046anatomyflower
PO:0020023anatomyouter integument
PO:0020038anatomypetiole
PO:0025257anatomyprimary root elongation zone
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001170developmental stageseed development stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007611developmental stagepetal differentiation and expansion stage
Sequence ? help Back to Top
Protein Sequence    Length: 747 aa     Download sequence    Send to blast
MSMAVDMSSK QPTKDFFSSP ALSLSLAGIF RNASSGSTNP EEDFLGRRVV DDEDRTVEMS  60
SENSGPTRSR SEEDLEGEDH DDEEEEEEDG AAGNKGTNKR KRKKYHRHTT DQIRHMEALF  120
KETPHPDEKQ RQQLSKQLGL APRQVKFWFQ NRRTQIKAIQ ERHENSLLKA ELEKLREENK  180
AMRESFSKAN SSCPNCGGGP DDLHLENSKL KAELDKLRAA LGRTPYPLQA SCSDDQEHRL  240
GSLDFYTGVF ALEKSRIAEI SNRATLELQK MATSGEPMWL RSVETGREIL NYDEYLKEFP  300
QAQASSFPGR KTIEASRDAG IVFMDAHKLA QSFMDVGQWK ETFACLISKA ATVDVIRQGE  360
GPSRIDGAIQ LMFGEMQLLT PVVPTREVYF VRSCRQLSPE KWAIVDVSVS VEDSNTEKEA  420
SLLKCRKLPS GCIIEDTSNG HSKVTWVEHL DVSASTVQPL FRSLVNTGLA FGARHWVATL  480
QLHCERLVFF MATNVPTKDS LGVTTLAGRK SVLKMAQRMT QSFYRAIAAS SYHQWTKITT  540
KTGQDMRVSS RKNLHDPGEP TGVIVCASSS LWLPVSPALL FDFFRDEARR HEWDALSNGA  600
HVQSIANLSK GQDRGNSVAI QTVKSREKSI WVLQDSSTNS YESVVVYAPV DINTTQLVLA  660
GHDPSNIQIL PSGFSIIPDG VESRPLVITS TQDDRNSQGG SLLTLALQTL INPSPAAKLN  720
MESVESVTNL VSVTLHNIKR SLQIEDC
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
199103RKRKK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.199860.0flower| seed
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible260166_at0.0
Expression AtlasAT1G79840-
AtGenExpressAT1G79840-
ATTED-IIAT1G79840-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in developing trichomes.
Functional Description ? help Back to Top
Source Description
TAIRGlabra 2, a homeodomain protein affects epidermal cell identity including trichomes, root hairs, and seed coat. It also down-regulates seed oil content. Expressed in atrichoblasts and required to suppress root hair development. Also expressed abundantly during early seed development. Directly regulated by WER.
UniProtProbable transcription factor required for correct morphological development and maturation of trichomes as well as for normal development of seed coat mucilage. Regulates the frequency of trichome initiation and determines trichome spacing. {ECO:0000269|PubMed:11844112}.
Function -- GeneRIF ? help Back to Top
  1. in addition to its known function in trichome and root hair development, GLABRA2 is involved in the control of seed oil accumulation
    [PMID: 16514561]
  2. Complexes containing R2R3 MYB and bHLH transcription factors regulate the expression of TTG2, which then regulates GL2 expression with complexes containing R2R3 MYB.
    [PMID: 17766401]
  3. Expression levels of GL1, MYB23, GL2 and TTG1 were reduced in shoots of sad2 mutants while expression levels of GL3 and ENHANCER OF GLABRA3 (EGL3) were enhanced.
    [PMID: 18713401]
  4. DNA binding of GL1 and GL3 via their own DNA-binding domains to the promoter of GL2 is probably required for the activation of GL2 expression.
    [PMID: 18948276]
  5. GL2 directly regulates cell wall-related gene expression during root development.
    [PMID: 19619157]
  6. These findings reveal distinct relationships between GL2 and single MYBs in the regulation of trichome vs root hair development, and provide new insights into the molecular mechanism of epidermal patterning.
    [PMID: 19878461]
  7. Seeds of the dominant-negative AtSKD1 under control of GS2 promoter display a transparent testa phenotype caused by a lack of proanthocyanidin (PA) and do not possess seed coat mucilage.
    [PMID: 20930567]
  8. A target of GL2 in the seed coat is the gene MUM4 and GL2 regulates seed oil production at least partly through its influence on MUM4 expression in the seed coat.
    [PMID: 21883555]
  9. Transcription factor GL2 and RHM2 are critical for the biosynthesis of mucilage pectin.
    [PMID: 22735692]
  10. Deletion of the START domain from Arabidopsis Glabra2, a representative HD-Zip transcription factor, results in a complete loss-of-function phenotype. The mammalian START domain from StAR can functionally replace the HD-Zip-derived START domain.
    [PMID: 25159688]
  11. Data show that both transcript levels and expression patterns of ENHANCER OF TRIPTYCHON AND CAPRICE1 (ETC1) in the root tip were affected in hda6 mutation.
    [PMID: 26143251]
  12. WER expressed ubiquitously in the root induced GL2 expression only in the root epidermis, whereas co-expression of WER and EGL3 induced GL2 expression in the corresponding tissues.
    [PMID: 26408906]
  13. These results indicate that GL2 directly suppresses basic helix-loop-helix (bHLH) genes with diverse functions in root hair development.
    [PMID: 26486447]
  14. The GIR1 and GIR2 might function as adaptor proteins that associate with GL2 and participate in control of root hair formation.
    [PMID: 28526410]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G79840.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Down-regulated by GEM. {ECO:0000269|PubMed:17450124}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Upstream Regulators) ? help Back to Top
Source Upstream Regulator (A: Activate/R: Repress)
ATRM AT1G01380 (R), AT1G63650 (A), AT1G71030 (R), AT2G37260 (A), AT2G46410 (R), AT3G13540 (A), AT3G27920 (A), AT4G09820 (A), AT4G36920 (A), AT5G14750 (A), AT5G35550 (A), AT5G40330 (A), AT5G41315 (A), AT5G53200 (R)
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source Target Gene (A: Activate/R: Repress)
ATRM AT1G12560(R), AT1G53500(A), AT3G16785(R), AT5G14750(R), AT5G53200(A)
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G79840
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3602940.0AF360294.1 Arabidopsis thaliana putative homeobox protein GLABRA2 (At1g79840) mRNA, complete cds.
GenBankBT0019560.0BT001956.1 Arabidopsis thaliana clone U09291 putative homeobox protein GLABRA2 (At1g79840) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_565223.10.0HD-ZIP IV family of homeobox-leucine zipper protein with lipid-binding START domain-containing protein
SwissprotP466070.0HGL2_ARATH; Homeobox-leucine zipper protein GLABRA 2
TrEMBLA0A178WBY60.0A0A178WBY6_ARATH; GL2
STRINGAT1G79840.20.0(Arabidopsis thaliana)
Publications ? help Back to Top
  1. Nagata T, et al.
    Gamma-radiation induces leaf trichome formation in Arabidopsis.
    Plant Physiol., 1999. 120(1): p. 113-20
    [PMID:10318689]
  2. Lee MM,Schiefelbein J
    WEREWOLF, a MYB-related protein in Arabidopsis, is a position-dependent regulator of epidermal cell patterning.
    Cell, 1999. 99(5): p. 473-83
    [PMID:10589676]
  3. Dolan L, et al.
    Cell fate in plants. Lessons from the Arabidopsis root.
    Symp. Soc. Exp. Biol., 1998. 51: p. 11-7
    [PMID:10645418]
  4. Bernhardt C,Tierney ML
    Expression of AtPRP3, a proline-rich structural cell wall protein from Arabidopsis, is regulated by cell-type-specific developmental pathways involved in root hair formation.
    Plant Physiol., 2000. 122(3): p. 705-14
    [PMID:10712533]
  5. Tavares R,Aubourg S,Lecharny A,Kreis M
    Organization and structural evolution of four multigene families in Arabidopsis thaliana: AtLCAD, AtLGT, AtMYST and AtHD-GL2.
    Plant Mol. Biol., 2000. 42(5): p. 703-17
    [PMID:10809443]
  6. Mendoza L,Alvarez-Buylla ER
    Genetic regulation of root hair development in Arabidopsis thaliana: a network model.
    J. Theor. Biol., 2000. 204(3): p. 311-26
    [PMID:10816357]
  7. Fyvie MJ,Murray JA,Kilby NJ
    Mosaic analysis of GL2 gene expression and cell layer autonomy during the specification of Arabidopsis leaf trichomes.
    Genesis, 2000. 28(2): p. 68-74
    [PMID:11064423]
  8. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  9. Dolan L,Costa S
    Evolution and genetics of root hair stripes in the root epidermis.
    J. Exp. Bot., 2001. 52(Spec Issue): p. 413-7
    [PMID:11326047]
  10. Imajuku Y,Ohashi Y,Aoyama T,Goto K,Oka A
    An upstream region of the Arabidopsis thaliana CDKA;1 (CDC2aAt) gene directs transcription during trichome development.
    Plant Mol. Biol., 2001. 46(2): p. 205-13
    [PMID:11442060]
  11. Lin Y,Schiefelbein J
    Embryonic control of epidermal cell patterning in the root and hypocotyl of Arabidopsis.
    Development, 2001. 128(19): p. 3697-705
    [PMID:11585796]
  12. Wubben MJ,Su H,Rodermel SR,Baum TJ
    Susceptibility to the sugar beet cyst nematode is modulated by ethylene signal transduction in Arabidopsis thaliana.
    Mol. Plant Microbe Interact., 2001. 14(10): p. 1206-12
    [PMID:11605960]
  13. Ohashi Y,Oka A,Ruberti I,Morelli G,Aoyama T
    Entopically additive expression of GLABRA2 alters the frequency and spacing of trichome initiation.
    Plant J., 2002. 29(3): p. 359-69
    [PMID:11844112]
  14. Lee MM,Schiefelbein J
    Cell pattern in the Arabidopsis root epidermis determined by lateral inhibition with feedback.
    Plant Cell, 2002. 14(3): p. 611-8
    [PMID:11910008]
  15. Souter M, et al.
    hydra Mutants of Arabidopsis are defective in sterol profiles and auxin and ethylene signaling.
    Plant Cell, 2002. 14(5): p. 1017-31
    [PMID:12034894]
  16. Sawa S
    Overexpression of the AtmybL2 gene represses trichome development in Arabidopsis.
    DNA Res., 2002. 9(2): p. 31-4
    [PMID:12056412]
  17. Leon-Kloosterziel KM,Keijzer CJ,Koornneef M
    A Seed Shape Mutant of Arabidopsis That Is Affected in Integument Development.
    Plant Cell, 1994. 6(3): p. 385-392
    [PMID:12244241]
  18. Schellmann S, et al.
    TRIPTYCHON and CAPRICE mediate lateral inhibition during trichome and root hair patterning in Arabidopsis.
    EMBO J., 2002. 21(19): p. 5036-46
    [PMID:12356720]
  19. Wada T, et al.
    Role of a positive regulator of root hair development, CAPRICE, in Arabidopsis root epidermal cell differentiation.
    Development, 2002. 129(23): p. 5409-19
    [PMID:12403712]
  20. Cho HT,Cosgrove DJ
    Regulation of root hair initiation and expansin gene expression in Arabidopsis.
    Plant Cell, 2002. 14(12): p. 3237-53
    [PMID:12468740]
  21. Schiefelbein J
    Cell-fate specification in the epidermis: a common patterning mechanism in the root and shoot.
    Curr. Opin. Plant Biol., 2003. 6(1): p. 74-8
    [PMID:12495754]
  22. Abe M,Katsumata H,Komeda Y,Takahashi T
    Regulation of shoot epidermal cell differentiation by a pair of homeodomain proteins in Arabidopsis.
    Development, 2003. 130(4): p. 635-43
    [PMID:12505995]
  23. Costa S,Dolan L
    Epidermal patterning genes are active during embryogenesis in Arabidopsis.
    Development, 2003. 130(13): p. 2893-901
    [PMID:12756173]
  24. Ohashi Y, et al.
    Modulation of phospholipid signaling by GLABRA2 in root-hair pattern formation.
    Science, 2003. 300(5624): p. 1427-30
    [PMID:12775839]
  25. Hiratsu K,Matsui K,Koyama T,Ohme-Takagi M
    Dominant repression of target genes by chimeric repressors that include the EAR motif, a repression domain, in Arabidopsis.
    Plant J., 2003. 34(5): p. 733-9
    [PMID:12787253]
  26. Kurata T, et al.
    The YORE-YORE gene regulates multiple aspects of epidermal cell differentiation in Arabidopsis.
    Plant J., 2003. 36(1): p. 55-66
    [PMID:12974811]
  27. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  28. Bernhardt C, et al.
    The bHLH genes GLABRA3 (GL3) and ENHANCER OF GLABRA3 (EGL3) specify epidermal cell fate in the Arabidopsis root.
    Development, 2003. 130(26): p. 6431-9
    [PMID:14627722]
  29. Western TL, et al.
    MUCILAGE-MODIFIED4 encodes a putative pectin biosynthetic enzyme developmentally regulated by APETALA2, TRANSPARENT TESTA GLABRA1, and GLABRA2 in the Arabidopsis seed coat.
    Plant Physiol., 2004. 134(1): p. 296-306
    [PMID:14701918]
  30. Ohashi Y
    [Roles and regulations of an Arabidopsis homeobox gene, GL2 in epidermal cell development].
    Tanpakushitsu Kakusan Koso, 2004. 49(2): p. 148-54
    [PMID:14969107]
  31. van Hengel AJ,Barber C,Roberts K
    The expression patterns of arabinogalactan-protein AtAGP30 and GLABRA2 reveal a role for abscisic acid in the early stages of root epidermal patterning.
    Plant J., 2004. 39(1): p. 70-83
    [PMID:15200643]
  32. Serna L
    A network of interacting factors triggering different cell fates.
    Plant Cell, 2004. 16(9): p. 2258-63
    [PMID:15342905]
  33. Montiel G,Gantet P,Jay-Allemand C,Breton C
    Transcription factor networks. Pathways to the knowledge of root development.
    Plant Physiol., 2004. 136(3): p. 3478-85
    [PMID:15542499]
  34. Esch JJ,Chen MA,Hillestad M,Marks MD
    Comparison of TRY and the closely related At1g01380 gene in controlling Arabidopsis trichome patterning.
    Plant J., 2004. 40(6): p. 860-9
    [PMID:15584952]
  35. Kirik V, et al.
    Functional diversification of MYB23 and GL1 genes in trichome morphogenesis and initiation.
    Development, 2005. 132(7): p. 1477-85
    [PMID:15728674]
  36. Koshino-Kimura Y, et al.
    Regulation of CAPRICE transcription by MYB proteins for root epidermis differentiation in Arabidopsis.
    Plant Cell Physiol., 2005. 46(6): p. 817-26
    [PMID:15795220]
  37. Serna L
    Epidermal cell patterning and differentiation throughout the apical-basal axis of the seedling.
    J. Exp. Bot., 2005. 56(418): p. 1983-9
    [PMID:15967776]
  38. Stadler R,Lauterbach C,Sauer N
    Cell-to-cell movement of green fluorescent protein reveals post-phloem transport in the outer integument and identifies symplastic domains in Arabidopsis seeds and embryos.
    Plant Physiol., 2005. 139(2): p. 701-12
    [PMID:16169962]
  39. Xu CR, et al.
    Histone acetylation affects expression of cellular patterning genes in the Arabidopsis root epidermis.
    Proc. Natl. Acad. Sci. U.S.A., 2005. 102(40): p. 14469-74
    [PMID:16176989]
  40. Ryu KH, et al.
    The WEREWOLF MYB protein directly regulates CAPRICE transcription during cell fate specification in the Arabidopsis root epidermis.
    Development, 2005. 132(21): p. 4765-75
    [PMID:16207757]
  41. Wang X
    Regulatory functions of phospholipase D and phosphatidic acid in plant growth, development, and stress responses.
    Plant Physiol., 2005. 139(2): p. 566-73
    [PMID:16219918]
  42. Dolan L
    Positional information and mobile transcriptional regulators determine cell pattern in the Arabidopsis root epidermis.
    J. Exp. Bot., 2006. 57(1): p. 51-4
    [PMID:16317033]
  43. Costa S,Shaw P
    Chromatin organization and cell fate switch respond to positional information in Arabidopsis.
    Nature, 2006. 439(7075): p. 493-6
    [PMID:16362059]
  44. Li M,Qin C,Welti R,Wang X
    Double knockouts of phospholipases Dzeta1 and Dzeta2 in Arabidopsis affect root elongation during phosphate-limited growth but do not affect root hair patterning.
    Plant Physiol., 2006. 140(2): p. 761-70
    [PMID:16384909]
  45. Shen B,Sinkevicius KW,Selinger DA,Tarczynski MC
    The homeobox gene GLABRA2 affects seed oil content in Arabidopsis.
    Plant Mol. Biol., 2006. 60(3): p. 377-87
    [PMID:16514561]
  46. Lee JY, et al.
    Transcriptional and posttranscriptional regulation of transcription factor expression in Arabidopsis roots.
    Proc. Natl. Acad. Sci. U.S.A., 2006. 103(15): p. 6055-60
    [PMID:16581911]
  47. Jakoby MJ, et al.
    Analysis of the subcellular localization, function, and proteolytic control of the Arabidopsis cyclin-dependent kinase inhibitor ICK1/KRP1.
    Plant Physiol., 2006. 141(4): p. 1293-305
    [PMID:16766674]
  48. Nakamura M, et al.
    Characterization of the class IV homeodomain-Leucine Zipper gene family in Arabidopsis.
    Plant Physiol., 2006. 141(4): p. 1363-75
    [PMID:16778018]
  49. Kwak SH,Schiefelbein J
    The role of the SCRAMBLED receptor-like kinase in patterning the Arabidopsis root epidermis.
    Dev. Biol., 2007. 302(1): p. 118-31
    [PMID:17027738]
  50. Caro E,Castellano MM,Gutierrez C
    A chromatin link that couples cell division to root epidermis patterning in Arabidopsis.
    Nature, 2007. 447(7141): p. 213-7
    [PMID:17450124]
  51. Wang S,Chang Y,Guo J,Chen JG
    Arabidopsis Ovate Family Protein 1 is a transcriptional repressor that suppresses cell elongation.
    Plant J., 2007. 50(5): p. 858-72
    [PMID:17461792]
  52. Wang YP, et al.
    [The mechanism of root hair development and molecular regulation in plants].
    Yi Chuan, 2007. 29(4): p. 413-9
    [PMID:17548302]
  53. Tominaga R,Iwata M,Okada K,Wada T
    Functional analysis of the epidermal-specific MYB genes CAPRICE and WEREWOLF in Arabidopsis.
    Plant Cell, 2007. 19(7): p. 2264-77
    [PMID:17644729]
  54. Ishida T, et al.
    Arabidopsis TRANSPARENT TESTA GLABRA2 is directly regulated by R2R3 MYB transcription factors and is involved in regulation of GLABRA2 transcription in epidermal differentiation.
    Plant Cell, 2007. 19(8): p. 2531-43
    [PMID:17766401]
  55. Morohashi K, et al.
    Participation of the Arabidopsis bHLH factor GL3 in trichome initiation regulatory events.
    Plant Physiol., 2007. 145(3): p. 736-46
    [PMID:17885086]
  56. Simon M,Lee MM,Lin Y,Gish L,Schiefelbein J
    Distinct and overlapping roles of single-repeat MYB genes in root epidermal patterning.
    Dev. Biol., 2007. 311(2): p. 566-78
    [PMID:17931617]
  57. Wang Y, et al.
    Salt-induced plasticity of root hair development is caused by ion disequilibrium in Arabidopsis thaliana.
    J. Plant Res., 2008. 121(1): p. 87-96
    [PMID:18060349]
  58. Motose H,Tominaga R,Wada T,Sugiyama M,Watanabe Y
    A NIMA-related protein kinase suppresses ectopic outgrowth of epidermal cells through its kinase activity and the association with microtubules.
    Plant J., 2008. 54(5): p. 829-44
    [PMID:18266916]
  59. Zhao M,Morohashi K,Hatlestad G,Grotewold E,Lloyd A
    The TTG1-bHLH-MYB complex controls trichome cell fate and patterning through direct targeting of regulatory loci.
    Development, 2008. 135(11): p. 1991-9
    [PMID:18434419]
  60. Guan XY, et al.
    The HD-Zip IV gene GaHOX1 from cotton is a functional homologue of the Arabidopsis GLABRA2.
    Physiol Plant, 2008. 134(1): p. 174-82
    [PMID:18507789]
  61. Shangguan XX,Xu B,Yu ZX,Wang LJ,Chen XY
    Promoter of a cotton fibre MYB gene functional in trichomes of Arabidopsis and glandular trichomes of tobacco.
    J. Exp. Bot., 2008. 59(13): p. 3533-42
    [PMID:18711121]
  62. Gao Y, et al.
    SAD2 in Arabidopsis functions in trichome initiation through mediating GL3 function and regulating GL1, TTG1 and GL2 expression.
    J Integr Plant Biol, 2008. 50(7): p. 906-17
    [PMID:18713401]
  63. Wang S,Chen JG
    Arabidopsis transient expression analysis reveals that activation of GLABRA2 may require concurrent binding of GLABRA1 and GLABRA3 to the promoter of GLABRA2.
    Plant Cell Physiol., 2008. 49(12): p. 1792-804
    [PMID:18948276]
  64. Gonzalez A,Mendenhall J,Huo Y,Lloyd A
    TTG1 complex MYBs, MYB5 and TT2, control outer seed coat differentiation.
    Dev. Biol., 2009. 325(2): p. 412-21
    [PMID:18992236]
  65. Ben
    Interlinked nonlinear subnetworks underlie the formation of robust cellular patterns in Arabidopsis epidermis: a dynamic spatial model.
    BMC Syst Biol, 2008. 2: p. 98
    [PMID:19014692]
  66. Li SF, et al.
    The Arabidopsis MYB5 transcription factor regulates mucilage synthesis, seed coat development, and trichome morphogenesis.
    Plant Cell, 2009. 21(1): p. 72-89
    [PMID:19136646]
  67. Reina-Pinto JJ, et al.
    Misexpression of FATTY ACID ELONGATION1 in the Arabidopsis epidermis induces cell death and suggests a critical role for phospholipase A2 in this process.
    Plant Cell, 2009. 21(4): p. 1252-72
    [PMID:19376931]
  68. Kang YH, et al.
    The MYB23 gene provides a positive feedback loop for cell fate specification in the Arabidopsis root epidermis.
    Plant Cell, 2009. 21(4): p. 1080-94
    [PMID:19395683]
  69. Arsovski AA,Villota MM,Rowland O,Subramaniam R,Western TL
    MUM ENHANCERS are important for seed coat mucilage production and mucilage secretory cell differentiation in Arabidopsis thaliana.
    J. Exp. Bot., 2009. 60(9): p. 2601-12
    [PMID:19401413]
  70. Kuppusamy KT,Chen AY,Nemhauser JL
    Steroids are required for epidermal cell fate establishment in Arabidopsis roots.
    Proc. Natl. Acad. Sci. U.S.A., 2009. 106(19): p. 8073-6
    [PMID:19416891]
  71. Arsovski AA, et al.
    AtBXL1 encodes a bifunctional beta-D-xylosidase/alpha-L-arabinofuranosidase required for pectic arabinan modification in Arabidopsis mucilage secretory cells.
    Plant Physiol., 2009. 150(3): p. 1219-34
    [PMID:19458117]
  72. Wang Y,Li X
    Salt stress-induced cell reprogramming, cell fate switch and adaptive plasticity during root hair development in Arabidopsis.
    Plant Signal Behav, 2008. 3(7): p. 436-8
    [PMID:19513233]
  73. Tominaga-Wada R, et al.
    The GLABRA2 homeodomain protein directly regulates CESA5 and XTH17 gene expression in Arabidopsis roots.
    Plant J., 2009. 60(3): p. 564-74
    [PMID:19619157]
  74. Marks MD,Wenger JP,Gilding E,Jilk R,Dixon RA
    Transcriptome analysis of Arabidopsis wild-type and gl3-sst sim trichomes identifies four additional genes required for trichome development.
    Mol Plant, 2009. 2(4): p. 803-22
    [PMID:19626137]
  75. Wang S,Barron C,Schiefelbein J,Chen JG
    Distinct relationships between GLABRA2 and single-repeat R3 MYB transcription factors in the regulation of trichome and root hair patterning in Arabidopsis.
    New Phytol., 2010. 185(2): p. 387-400
    [PMID:19878461]
  76. Chai G, et al.
    Brassica GLABRA2 genes: analysis of function related to seed oil content and development of functional markers.
    Theor. Appl. Genet., 2010. 120(8): p. 1597-610
    [PMID:20162256]
  77. Hassan H,Scheres B,Blilou I
    JACKDAW controls epidermal patterning in the Arabidopsis root meristem through a non-cell-autonomous mechanism.
    Development, 2010. 137(9): p. 1523-9
    [PMID:20356954]
  78. Shahriari M, et al.
    The AAA-type ATPase AtSKD1 contributes to vacuolar maintenance of Arabidopsis thaliana.
    Plant J., 2010. 64(1): p. 71-85
    [PMID:20663085]
  79. Shahriari M,H
    Seeds of Arabidopsis plants expressing dominant-negative AtSKD1 under control of the GL2 promoter show a transparent testa phenotype and a mucilage defect.
    Plant Signal Behav, 2010. 5(10): p. 1308-10
    [PMID:20930567]
  80. Kubo H,Hayashi K
    Characterization of root cells of anl2 mutant in Arabidopsis thaliana.
    Plant Sci., 2011. 180(5): p. 679-85
    [PMID:21421418]
  81. Niu Y, et al.
    Auxin modulates the enhanced development of root hairs in Arabidopsis thaliana (L.) Heynh. under elevated CO(2).
    Plant Cell Environ., 2011. 34(8): p. 1304-17
    [PMID:21477123]
  82. O'Neill CM, et al.
    Towards the genetic architecture of seed lipid biosynthesis and accumulation in Arabidopsis thaliana.
    Heredity (Edinb), 2012. 108(2): p. 115-23
    [PMID:21731053]
  83. Shi L,Katavic V,Yu Y,Kunst L,Haughn G
    Arabidopsis glabra2 mutant seeds deficient in mucilage biosynthesis produce more oil.
    Plant J., 2012. 69(1): p. 37-46
    [PMID:21883555]
  84. Song SK, et al.
    Cell fate in the Arabidopsis root epidermis is determined by competition between WEREWOLF and CAPRICE.
    Plant Physiol., 2011. 157(3): p. 1196-208
    [PMID:21914815]
  85. Gan L,Xia K,Chen JG,Wang S
    Functional characterization of TRICHOMELESS2, a new single-repeat R3 MYB transcription factor in the regulation of trichome patterning in Arabidopsis.
    BMC Plant Biol., 2011. 11: p. 176
    [PMID:22168948]
  86. Tominaga-Wada R,Nukumizu Y,Wada T
    Amino acid substitution converts WEREWOLF function from an activator to a repressor of Arabidopsis non-hair cell development.
    Plant Sci., 2012. 183: p. 37-42
    [PMID:22195575]
  87. Bruex A, et al.
    A gene regulatory network for root epidermis cell differentiation in Arabidopsis.
    PLoS Genet., 2012. 8(1): p. e1002446
    [PMID:22253603]
  88. Zhao H, et al.
    A single amino acid substitution in IIIf subfamily of basic helix-loop-helix transcription factor AtMYC1 leads to trichome and root hair patterning defects by abolishing its interaction with partner proteins in Arabidopsis.
    J. Biol. Chem., 2012. 287(17): p. 14109-21
    [PMID:22334670]
  89. Hirano T, et al.
    Molecular nature of mutations induced by high-LET irradiation with argon and carbon ions in Arabidopsis thaliana.
    Mutat. Res., 2012. 735(1-2): p. 19-31
    [PMID:22579628]
  90. Vasilevski A,Giorgi FM,Bertinetti L,Usadel B
    LASSO modeling of the Arabidopsis thaliana seed/seedling transcriptome: a model case for detection of novel mucilage and pectin metabolism genes.
    Mol Biosyst, 2012. 8(10): p. 2566-74
    [PMID:22735692]
  91. Lin Q,Qing L,Aoyama T
    Pathways for epidermal cell differentiation via the homeobox gene GLABRA2: update on the roles of the classic regulator.
    J Integr Plant Biol, 2012. 54(10): p. 729-37
    [PMID:22943441]
  92. Hartmann J,St
    Phytosulfokine control of growth occurs in the epidermis, is likely to be non-cell autonomous and is dependent on brassinosteroids.
    Plant J., 2013. 73(4): p. 579-90
    [PMID:23083315]
  93. Rigas S, et al.
    Root gravitropism and root hair development constitute coupled developmental responses regulated by auxin homeostasis in the Arabidopsis root apex.
    New Phytol., 2013. 197(4): p. 1130-41
    [PMID:23252740]
  94. Tominaga-Wada R,Nukumizu Y,Sato S,Wada T
    Control of plant trichome and root-hair development by a tomato (Solanum lycopersicum) R3 MYB transcription factor.
    PLoS ONE, 2013. 8(1): p. e54019
    [PMID:23326563]
  95. Wang G,Zhao GH,Jia YH,Du XM
    Identification and characterization of cotton genes involved in fuzz-fiber development.
    J Integr Plant Biol, 2013. 55(7): p. 619-30
    [PMID:23710824]
  96. Schrick K, et al.
    Shared functions of plant and mammalian StAR-related lipid transfer (START) domains in modulating transcription factor activity.
    BMC Biol., 2014. 12: p. 70
    [PMID:25159688]
  97. Zhao JL, et al.
    Micro-trichome as a class I homeodomain-leucine zipper gene regulates multicellular trichome development in Cucumis sativus.
    J Integr Plant Biol, 2015. 57(11): p. 925-35
    [PMID:25735194]
  98. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]
  99. Li DX,Chen WQ,Xu ZH,Bai SN
    HISTONE DEACETYLASE6-Defective Mutants Show Increased Expression and Acetylation of ENHANCER OF TRIPTYCHON AND CAPRICE1 and GLABRA2 with Small But Significant Effects on Root Epidermis Cellular Pattern.
    Plant Physiol., 2015. 168(4): p. 1448-58
    [PMID:26143251]
  100. Song SK,Kwak SH,Chang SC,Schiefelbein J,Lee MM
    WEREWOLF and ENHANCER of GLABRA3 are interdependent regulators of the spatial expression pattern of GLABRA2 in Arabidopsis.
    Biochem. Biophys. Res. Commun., 2015. 467(1): p. 94-100
    [PMID:26408906]
  101. Lin Q, et al.
    GLABRA2 Directly Suppresses Basic Helix-Loop-Helix Transcription Factor Genes with Diverse Functions in Root Hair Development.
    Plant Cell, 2015. 27(10): p. 2894-906
    [PMID:26486447]
  102. Wu R,Citovsky V
    Adaptor proteins GIR1 and GIR2. I. Interaction with the repressor GLABRA2 and regulation of root hair development.
    Biochem. Biophys. Res. Commun., 2017. 488(3): p. 547-553
    [PMID:28526410]
  103. Rerie WG,Feldmann KA,Marks MD
    The GLABRA2 gene encodes a homeo domain protein required for normal trichome development in Arabidopsis.
    Genes Dev., 1994. 8(12): p. 1388-99
    [PMID:7926739]
  104. Masucci JD, et al.
    The homeobox gene GLABRA2 is required for position-dependent cell differentiation in the root epidermis of Arabidopsis thaliana.
    Development, 1996. 122(4): p. 1253-60
    [PMID:8620852]
  105. Di Cristina M, et al.
    The Arabidopsis Athb-10 (GLABRA2) is an HD-Zip protein required for regulation of root hair development.
    Plant J., 1996. 10(3): p. 393-402
    [PMID:8811855]
  106. Masucci JD,Schiefelbein JW
    Hormones act downstream of TTG and GL2 to promote root hair outgrowth during epidermis development in the Arabidopsis root.
    Plant Cell, 1996. 8(9): p. 1505-17
    [PMID:8837505]
  107. Lu P,Porat R,Nadeau JA,O'Neill SD
    Identification of a meristem L1 layer-specific gene in Arabidopsis that is expressed during embryonic pattern formation and defines a new class of homeobox genes.
    Plant Cell, 1996. 8(12): p. 2155-68
    [PMID:8989876]
  108. Szymanski DB,Jilk RA,Pollock SM,Marks MD
    Control of GL2 expression in Arabidopsis leaves and trichomes.
    Development, 1998. 125(7): p. 1161-71
    [PMID:9477315]
  109. Hung CY, et al.
    A common position-dependent mechanism controls cell-type patterning and GLABRA2 regulation in the root and hypocotyl epidermis of Arabidopsis.
    Plant Physiol., 1998. 117(1): p. 73-84
    [PMID:9576776]
  110. Schneider K, et al.
    The ROOT HAIRLESS 1 gene encodes a nuclear protein required for root hair initiation in Arabidopsis.
    Genes Dev., 1998. 12(13): p. 2013-21
    [PMID:9649505]