PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G79580.1
Common NameANAC033, F20B17.1, NAC033, SMB, URP7
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NAC
Protein Properties Length: 371aa    MW: 42381.8 Da    PI: 7.2243
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G79580.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM169.98.2e-53171461128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                  +ppGfrFhPt+eel+ +yLkkkv+ ++++l +vi+evd++k+ePw+L++  ++ +  ++ewyfFs++dkky+tg+r+nrat++g+Wkatg+dk+++ +
  AT1G79580.1  17 VPPGFRFHPTEEELLYYYLKKKVSYEPIDL-DVIREVDLNKLEPWELKEkcRIGSgPQNEWYFFSHKDKKYPTGTRTNRATAAGFWKATGRDKSIHLN 113
                  69****************************.9***************952444443456*************************************** PP

          NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                  +++++gl+ktLvfy+grap+g+kt+W+mheyrl
  AT1G79580.1 114 SSKKIGLRKTLVFYTGRAPHGQKTEWIMHEYRL 146
                  *******************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019419.94E-5910166IPR003441NAC domain
PROSITE profilePS5100557.7317166IPR003441NAC domain
PfamPF023653.1E-2718146IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003002Biological Processregionalization
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0010455Biological Processpositive regulation of cell fate commitment
GO:0048829Biological Processroot cap development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020131anatomylateral root cap
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 371 aa     Download sequence    Send to blast
MEIGSSSTVA GGGQLSVPPG FRFHPTEEEL LYYYLKKKVS YEPIDLDVIR EVDLNKLEPW  60
ELKEKCRIGS GPQNEWYFFS HKDKKYPTGT RTNRATAAGF WKATGRDKSI HLNSSKKIGL  120
RKTLVFYTGR APHGQKTEWI MHEYRLDDSE NEIQEDGWVV CRVFKKKNHF RGFHQEQEQD  180
HHHHHQYIST NNDHDHHHHI DSNSNNHSPL ILHPLDHHHH HHHIGRQIHM PLHEFANTLS  240
HGSMHLPQLF SPDSAAAAAA AAASAQPFVS PINTTDIECS QNLLRLTSNN NYGGDWSFLD  300
KLLTTGNMNQ QQQQQVQNHQ AKCFGDLSNN DNNDQADHLG NNNGGSSSSP VNQRFPFHYL  360
GNDANLLKFP K
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B3e-501416814167NAC domain-containing protein 19
4dul_A3e-501416814167NAC domain-containing protein 19
1ut7_B3e-501416814167NO APICAL MERISTEM PROTEIN
1ut7_A3e-501416814167NO APICAL MERISTEM PROTEIN
1ut4_B3e-501416814167NO APICAL MERISTEM PROTEIN
1ut4_A3e-501416814167NO APICAL MERISTEM PROTEIN
3swp_D4e-501416817170NAC domain-containing protein 19
3swp_C4e-501416817170NAC domain-containing protein 19
3swp_B4e-501416817170NAC domain-containing protein 19
3swp_A4e-501416817170NAC domain-containing protein 19
3swm_D4e-501416817170NAC domain-containing protein 19
3swm_C4e-501416817170NAC domain-containing protein 19
3swm_B4e-501416817170NAC domain-containing protein 19
3swm_A4e-501416817170NAC domain-containing protein 19
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO425633530.0
Genevisible261393_at0.0
Expression AtlasAT1G79580-
AtGenExpressAT1G79580-
ATTED-IIAT1G79580-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: First expressed at early heart stage onward in all root basal daughter cells resulting from horizontal divisions in the COL progenitors and is later maintained in these cells. Present in root stem cell daughters and accumulates in maturing root cap layers. Detectable from very early stages of lateral root development. {ECO:0000269|PubMed:19081078, ECO:0000269|PubMed:20197506}.
UniprotTISSUE SPECIFICITY: Accumulates in maturing root cap cells, in both COL and LRC cells. {ECO:0000269|PubMed:19081078, ECO:0000269|PubMed:20197506}.
Functional Description ? help Back to Top
Source Description
TAIRNAC-domain protein. Involved in root cap development. Involved in a regulatory feedback loop with FEZ. FEZ activates SMB in hte root cap daughter cells soon after division, and SMB in turn represses FEZ expression in these cells, thereby preventing further stem cell divisions.
UniProtTranscription regulator. Together with BRN1 and BRN2, regulates cellular maturation of root cap. Represses stem cell-like divisions in the root cap daughter cells, and thus promotes daughter cell fate. Inhibits expression of its positive regulator FEZ in a feedback loop for controlled switches in cell division plane. Promotes the expression of genes involved in secondary cell walls (SCW) biosynthesis. {ECO:0000269|PubMed:19081078, ECO:0000269|PubMed:20197506}.
Function -- GeneRIF ? help Back to Top
  1. FEZ and SOMBRERO (SMB), two plant-specific NAC-domain transcription factors, control the orientation of cell division plane in Arabidopsis root stem cells.
    [PMID: 19081078]
  2. SMB, BRN1, and BRN2 act redundantly to drive cellular differentiation and promote maturation of the root cap and the cell wall separations needed to produce a functional root cap.
    [PMID: 20197506]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00250DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G79580.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By FEZ in oriented-divised root cap stem cells. {ECO:0000269|PubMed:19081078}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Upstream Regulators) ? help Back to Top
Source Upstream Regulator (A: Activate/R: Repress)
ATRM AT1G26870 (A)
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source Target Gene (A: Activate/R: Repress)
ATRM AT1G26870(R)
Phenotype -- Disruption Phenotype ? help Back to Top
Source Description
UniProtDISRUPTION PHENOTYPE: Additional root cap layers; increased number of columella (COL) and lateral root cap (LRC) cell layers in the mature embryo and in the postembryonic state. Lateral cap cells continue to divide and fail to detach from the root. {ECO:0000269|PubMed:19081078, ECO:0000269|PubMed:20197506}.
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G79580
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0107930.0AC010793.3 Genomic sequence for Arabidopsis thaliana BAC F20B17 from chromosome I, complete sequence.
GenBankCP0026840.0CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_974179.10.0protein SOMBRERO
RefseqNP_178076.10.0protein SOMBRERO
RefseqNP_974178.10.0protein SOMBRERO
SwissprotQ9MA170.0SMB_ARATH; Protein SOMBRERO
TrEMBLR0GHU80.0R0GHU8_9BRAS; Uncharacterized protein
STRINGAT1G79580.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1715800
MalvidsOGEM66532542
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Castelli V, et al.
    Whole genome sequence comparisons and "full-length" cDNA sequences: a combined approach to evaluate and improve Arabidopsis genome annotation.
    Genome Res., 2004. 14(3): p. 406-13
    [PMID:14993207]
  3. Ooka H, et al.
    Comprehensive analysis of NAC family genes in Oryza sativa and Arabidopsis thaliana.
    DNA Res., 2003. 10(6): p. 239-47
    [PMID:15029955]
  4. Czechowski T,Bari RP,Stitt M,Scheible WR,Udvardi MK
    Real-time RT-PCR profiling of over 1400 Arabidopsis transcription factors: unprecedented sensitivity reveals novel root- and shoot-specific genes.
    Plant J., 2004. 38(2): p. 366-79
    [PMID:15078338]
  5. Willemsen V, et al.
    The NAC domain transcription factors FEZ and SOMBRERO control the orientation of cell division plane in Arabidopsis root stem cells.
    Dev. Cell, 2008. 15(6): p. 913-22
    [PMID:19081078]
  6. Bennett T, et al.
    SOMBRERO, BEARSKIN1, and BEARSKIN2 regulate root cap maturation in Arabidopsis.
    Plant Cell, 2010. 22(3): p. 640-54
    [PMID:20197506]
  7. Waki T, et al.
    A GAL4-based targeted activation tagging system in Arabidopsis thaliana.
    Plant J., 2013. 73(3): p. 357-67
    [PMID:23057675]
  8. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]