PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G79430.2
Common NameAPL, FE, PHL14, PHR2, T8K14.15, WDY
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family G2-like
Protein Properties Length: 358aa    MW: 39597.5 Da    PI: 8.9827
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G79430.2genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1071.1e-333488155
      G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                 kprlrWt eLHerFv+av+qLGG++kAtPkti+++m+vkgLtl+h+kSHLQk+Rl
  AT1G79430.2 34 KPRLRWTVELHERFVDAVAQLGGPDKATPKTIMRVMGVKGLTLYHLKSHLQKFRL 88
                 79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.8013191IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.8E-323189IPR009057Homeodomain-like
SuperFamilySSF466891.77E-163389IPR009057Homeodomain-like
TIGRFAMsTIGR015571.3E-233489IPR006447Myb domain, plants
PfamPF002492.6E-83686IPR001005SANT/Myb domain
PfamPF143791.9E-21129169IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009908Biological Processflower development
GO:0010088Biological Processphloem development
GO:0010089Biological Processxylem development
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000293anatomyguard cell
PO:0006077anatomyprotophloem
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007057developmental stageseed germination stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 358 aa     Download sequence    Send to blast
MFHAKKPSSM NGSYENRAMC VQGDSGLVLT TDPKPRLRWT VELHERFVDA VAQLGGPDKA  60
TPKTIMRVMG VKGLTLYHLK SHLQKFRLGK QPHKEYGDHS TKEGSRASAM DIQRNVASSS  120
GMMSRNMNEM QMEVQRRLHE QLEVQRHLQL RIEAQGKYMQ SILERACQTL AGENMAAATA  180
AAAVGGGYKG NLGSSSLSAA VGPPPHPLSF PPFQDLNIYG NTTDQVLDHH NFHHQNIENH  240
FTGNNAADTN IYLGKKRPNP NFGNDVRKGL LMWSDQDHDL SANQSIDDEH RIQIQMATHV  300
STDLDSLSEI YERKSGLSGD EGNNGGKLLE RPSPRRSPLS PMMNPNGGLI QGRNSPFG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A2e-183490157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-183490157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-183490157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-183490157Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.235500.0bud| seed| silique
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO306994160.0
Genevisible262921_at0.0
Expression AtlasAT1G79430-
AtGenExpressAT1G79430-
ATTED-IIAT1G79430-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Specifically expressed in the developing protophloem sieve elements soon after the phloem-specific cell divisions have taken place. Also found in the companion cells and metaphloem sieve elements. May not be necessary for the initial steps of protophloem differentiation. {ECO:0000269|PubMed:14614507, ECO:0000269|PubMed:18523061}.
UniprotTISSUE SPECIFICITY: Expressed in shoots and roots, specifically in the developing protophloem sieve elements (PubMed:14614507). Detected in phloem and/or cambium (PubMed:15923329). Expressed in the phloem tissues of various organs, including leaves and cotyledons, during vegetative growth (PubMed:26239308). {ECO:0000269|PubMed:14614507, ECO:0000269|PubMed:15923329, ECO:0000269|PubMed:26239308}.
Functional Description ? help Back to Top
Source Description
TAIREncodes gene product that is required for several aspects of phloem development in the root: (1) the specific divisions organizing the phloem pole, (2) sieve element differentiation and (3) the expression of a companion-specific gene. Mutant has a defect in the organization of phloem poles in the root. apl seedlings have a short, determinate root with only occasional lateral branches.
UniProtTranscription factor required for phloem identity. Has a dual role both in promoting phloem differentiation and in repressing xylem differentiation during vascular development. Regulates the expression of the transcription factor NAC045 (AC A4VCM0). May activate the transcription of specific genes involved in phosphate uptake or assimilation (PubMed:15592750). Promotes flowering through transcriptional activation of both FT and its transport machinery component, FTIP1 (PubMed:26239308). {ECO:0000269|PubMed:14614507, ECO:0000269|PubMed:18523061, ECO:0000269|PubMed:25081480, ECO:0000269|PubMed:26239308, ECO:0000305|PubMed:15592750}.
Function -- GeneRIF ? help Back to Top
  1. The FE protein regulates the expression of FTIP1 involved in FT transport. FE protein promotes flowering through transcriptional activation of FT and Ftip1.
    [PMID: 26239308]
  2. APL (FE protein) regulates the transcription of FT and florigen transporter genes in different manners in leaf phloem companion cells.
    [PMID: 29036620]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G79430.2
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by phosphate deficiency. {ECO:0000269|PubMed:15592750}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
IntActSearch Q9SAK5
Phenotype -- Disruption Phenotype ? help Back to Top
Source Description
UniProtDISRUPTION PHENOTYPE: Differentiation of tracheary-like elements of xyleme at the site of the phloem pole leading to seedling lethality. {ECO:0000269|PubMed:14614507}.
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G79430
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3167190.0AK316719.1 Arabidopsis thaliana AT1G79430 mRNA, complete cds, clone: RAFL09-57-C07.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_849905.10.0Homeodomain-like superfamily protein
SwissprotQ9SAK50.0APL_ARATH; Myb family transcription factor APL
TrEMBLD7KWH80.0D7KWH8_ARALL; Uncharacterized protein (Fragment)
STRINGAT1G79430.20.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM50442750
Representative plantOGRP7817262
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Rubio V, et al.
    A conserved MYB transcription factor involved in phosphate starvation signaling both in vascular plants and in unicellular algae.
    Genes Dev., 2001. 15(16): p. 2122-33
    [PMID:11511543]
  3. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  4. Bonke M,Thitamadee S,Mähönen AP,Hauser MT,Helariutta Y
    APL regulates vascular tissue identity in Arabidopsis.
    Nature, 2003. 426(6963): p. 181-6
    [PMID:14614507]
  5. Todd CD,Zeng P,Huete AM,Hoyos ME,Polacco JC
    Transcripts of MYB-like genes respond to phosphorous and nitrogen deprivation in Arabidopsis.
    Planta, 2004. 219(6): p. 1003-9
    [PMID:15592750]
  6. Zhao C,Craig JC,Petzold HE,Dickerman AW,Beers EP
    The xylem and phloem transcriptomes from secondary tissues of the Arabidopsis root-hypocotyl.
    Plant Physiol., 2005. 138(2): p. 803-18
    [PMID:15923329]
  7. Truernit E, et al.
    High-resolution whole-mount imaging of three-dimensional tissue organization and gene expression enables the study of Phloem development and structure in Arabidopsis.
    Plant Cell, 2008. 20(6): p. 1494-503
    [PMID:18523061]
  8. Tang RJ, et al.
    The woody plant poplar has a functionally conserved salt overly sensitive pathway in response to salinity stress.
    Plant Mol. Biol., 2010. 74(4-5): p. 367-80
    [PMID:20803312]
  9. Arabidopsis Interactome Mapping Consortium
    Evidence for network evolution in an Arabidopsis interactome map.
    Science, 2011. 333(6042): p. 601-7
    [PMID:21798944]
  10. Martínez-Navarro AC,Galván-Gordillo SV,Xoconostle-Cázares B,Ruiz-Medrano R
    Vascular gene expression: a hypothesis.
    Front Plant Sci, 2013. 4: p. 261
    [PMID:23882276]
  11. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  12. Furuta KM, et al.
    Plant development. Arabidopsis NAC45/86 direct sieve element morphogenesis culminating in enucleation.
    Science, 2014. 345(6199): p. 933-7
    [PMID:25081480]
  13. Abe M, et al.
    FE, a phloem-specific Myb-related protein, promotes flowering through transcriptional activation of FLOWERING LOCUS T and FLOWERING LOCUS T INTERACTING PROTEIN 1.
    Plant J., 2015. 83(6): p. 1059-68
    [PMID:26239308]
  14. Kondo Y, et al.
    Vascular Cell Induction Culture System Using Arabidopsis Leaves (VISUAL) Reveals the Sequential Differentiation of Sieve Element-Like Cells.
    Plant Cell, 2016. 28(6): p. 1250-62
    [PMID:27194709]
  15. Shibuta M,Abe M
    FE Controls the Transcription of Downstream Flowering Regulators Through Two Distinct Mechanisms in Leaf Phloem Companion Cells.
    Plant Cell Physiol., 2017. 58(11): p. 2017-2025
    [PMID:29036620]